Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 10.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q8IZQ5 Q8N672 SelH
Symbols SELH
C11orf31
C17orf10

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (9)

AA Sequence

MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVN      1 - 70
PTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS                       71 - 122
//

Text Mined References (18)

PMID Year Title