Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 10.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (8)

PMID Text
25336634 Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation.
23220172 We conclude that the effects of selenoprotein H on mitochondrial biogenesis and mitochondrial function are probably mediated through protein kinase A-CREB-PGC-1alpha and Akt/protein kinase B-CREB-PGC-1alpha pathways.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20656065 Overexpression of SelH promotes mitochondrial biogenesis and improves mitochondrial functional performance.
19766117 t SelH protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways
17526492 selenoprotein H is a redox-responsive DNA-binding protein of the AT-hook family and functions in regulating expression levels of genes involved in de novo glutathione synthesis and phase II detoxification in response to redox status.
17389926 hSelH overexpression protects cells from UVB irradiation-induced murine hippocampal neuronal cell death by reducing the superoxide formation.
17337453 SelH is a novel nucleolar oxidoreductase that may have functions which are regulated by redox and dependent on the trace element selenium

AA Sequence

MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVN      1 - 70
PTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS                       71 - 122
//

Text Mined References (16)

PMID Year Title
25336634 2014 Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23220172 2013 Overexpression of human selenoprotein H in neuronal cells enhances mitochondrial biogenesis and function through activation of protein kinase A, protein kinase B, and cyclic adenosine monophosphate response element-binding protein pathway.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20656065 2011 Upregulation of human selenoprotein H in murine hippocampal neuronal cells promotes mitochondrial biogenesis and functional performance.
19766117 2009 Overexpression of human selenoprotein H in neuronal cells ameliorates ultraviolet irradiation-induced damage by modulating cell signaling pathways.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...