Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.43
PubTator Score 13.25

Knowledge Summary

Patent (6,961)

Expression

  Differential Expression (8)

Disease log2 FC p
Endometriosis 1.489 2.3e-02
ependymoma 1.700 4.0e-04
gastric carcinoma -2.800 4.6e-02
intraductal papillary-mucinous adenoma (... 3.400 9.6e-04
malignant mesothelioma -1.100 3.6e-04
ovarian cancer 2.300 4.5e-04
pituitary cancer -1.400 4.6e-02
psoriasis -1.300 2.4e-26

Gene RIF (3)

AA Sequence

MVFSVRQCGHVGRTEEVLLTFKIFLVIICLHVVLVTSLEEDTDNSSLSPPPAKLSVVSFAPSSNGTPEVE      1 - 70
TTSLNDVTLSLLPSNETEKTKITIVKTFNASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQ     71 - 140
HITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVIAALERVK    141 - 210
IRPMEHCCCSVRIPCPSSPEELEKLQCDLQDPIVCLADHPRGPPFSSSQSIPVVPRATVLSQVPKATSFA    211 - 280
EPPDYSPVTHNVPSPIGEIQPLSPQPSAPIASSPAIDMPPQSETISSPMPQTHVSGTPPPVKASFSSPTV    281 - 350
SAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLA    351 - 420
QRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPENSIGTIT    421 - 490
LPSSLMNNLPAHDMELASRVQFNFFETPALFQDPSLENLSLISYVISSSVANLTVRNLTRNVTVTLKHIN    491 - 560
PSQDELTVRCVFWDLGRNGGRGGWSDNGCSVKDRRLNETICTCSHLTSFGVLLDLSRTSVLPAQMMALTF    561 - 630
ITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVF    631 - 700
LHYFLLVSFTWMGLEAFHMYLALVKVFNTYIRKYILKFCIVGWGVPAVVVTIILTISPDNYGLGSYGKFP    701 - 770
NGSPDDFCWINNNAVFYITVVGYFCVIFLLNVSMFIVVLVQLCRIKKKKQLGAQRKTSIQDLRSIAGLTF    771 - 840
LLGITWGFAFFAWGPVNVTFMYLFAIFNTLQGFFIFIFYCVAKENVRKQWRRYLCCGKLRLAENSDWSKT    841 - 910
ATNGLKKQTVNQGVSSSSNSLQSSSNSTNSTTLLVNNDCSVHASGNGNASTERNGVSFSVQNGDVCLHDF    911 - 980
TGKQHMFNEKEDSCNGKGRMALRRTSKRGSLHFIEQM                                     981 - 1017
//

Text Mined References (21)

PMID Year Title