Property Summary

NCBI Gene PubMed Count 11
PubMed Score 20.70
PubTator Score 13.25

Knowledge Summary

Patent (6,961)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
posterior fossa group A ependymoma 1.800 0.000
intraductal papillary-mucinous adenoma (... 3.400 0.001
Endometriosis 1.489 0.023
gastric carcinoma -2.800 0.046
ovarian cancer 2.300 0.000
pituitary cancer -1.400 0.046
psoriasis -1.300 0.000

Gene RIF (1)

PMID Text
26321231 Knockdown of ADGRG2 breast cancer cell lines resulted in a strong reduction in cell adhesion and subsequent cell migration which was associated with a selective reduction in RelB.

AA Sequence

MVFSVRQCGHVGRTEEVLLTFKIFLVIICLHVVLVTSLEEDTDNSSLSPPPAKLSVVSFAPSSNGTPEVE      1 - 70
TTSLNDVTLSLLPSNETEKTKITIVKTFNASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQ     71 - 140
HITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVIAALERVK    141 - 210
IRPMEHCCCSVRIPCPSSPEELEKLQCDLQDPIVCLADHPRGPPFSSSQSIPVVPRATVLSQVPKATSFA    211 - 280
EPPDYSPVTHNVPSPIGEIQPLSPQPSAPIASSPAIDMPPQSETISSPMPQTHVSGTPPPVKASFSSPTV    281 - 350
SAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLA    351 - 420
QRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPENSIGTIT    421 - 490
LPSSLMNNLPAHDMELASRVQFNFFETPALFQDPSLENLSLISYVISSSVANLTVRNLTRNVTVTLKHIN    491 - 560
PSQDELTVRCVFWDLGRNGGRGGWSDNGCSVKDRRLNETICTCSHLTSFGVLLDLSRTSVLPAQMMALTF    561 - 630
ITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVF    631 - 700
LHYFLLVSFTWMGLEAFHMYLALVKVFNTYIRKYILKFCIVGWGVPAVVVTIILTISPDNYGLGSYGKFP    701 - 770
NGSPDDFCWINNNAVFYITVVGYFCVIFLLNVSMFIVVLVQLCRIKKKKQLGAQRKTSIQDLRSIAGLTF    771 - 840
LLGITWGFAFFAWGPVNVTFMYLFAIFNTLQGFFIFIFYCVAKENVRKQWRRYLCCGKLRLAENSDWSKT    841 - 910
ATNGLKKQTVNQGVSSSSNSLQSSSNSTNSTTLLVNNDCSVHASGNGNASTERNGVSFSVQNGDVCLHDF    911 - 980
TGKQHMFNEKEDSCNGKGRMALRRTSKRGSLHFIEQM                                     981 - 1017
//

Text Mined References (19)

PMID Year Title
26321231 2015 The adhesion G protein-coupled receptor G2 (ADGRG2/GPR64) constitutively activates SRE and NF?B and is involved in cell adhesion and migration.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
23338946 2013 G-Protein coupled receptor 64 promotes invasiveness and metastasis in Ewing sarcomas through PGF and MMP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469038 2008 HE6/GPR64 adhesion receptor co-localizes with apical and subapical F-actin scaffold in male excurrent duct epithelia.
More...