Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.31
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.500 0.003
ependymoma -3.400 0.000
oligodendroglioma -2.300 0.000
glioblastoma -4.600 0.000
medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -3.100 0.002
adult high grade glioma -4.100 0.000
pilocytic astrocytoma -2.400 0.000
aldosterone-producing adenoma 1.332 0.013
Pick disease -1.500 0.003
Breast cancer 1.400 0.001
ovarian cancer -1.900 0.000
psoriasis -1.300 0.000

Gene RIF (2)

PMID Text
24371161 Single-nucleotide polymorphisms within the HS6ST3 gene are associated with obesity and triglyceride levels. [Meta-analysis]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDERFNKWLLTPVLTLLFVVIMYQYVSPSCTSSCTNFGEQPRAGEAGPPAVPGPARRAQAPPEEWERRPQ      1 - 70
LPPPPRGPPEGPRGAAAPEEEDEEPGDPREGEEEEEEDEPDPEAPENGSLPRFVPRFNFSLKDLTRFVDF     71 - 140
NIKGRDVIVFLHIQKTGGTTFGRHLVKNIRLEQPCSCKAGQKKCTCHRPGKKETWLFSRFSTGWSCGLHA    141 - 210
DWTELTNCVPAIMEKKDCPRNHSHTRNFYYITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDE    211 - 280
LPTCYPGDDWSGVSLREFMDCTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAF    281 - 350
FGLTEFQRKTQFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYAKDLFQQRYH    351 - 420
HTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW                       421 - 471
//

Text Mined References (13)

PMID Year Title
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24371161 2013 Association of HS6ST3 gene polymorphisms with obesity and triglycerides: gene x gender interaction.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
21647334 2011 The heparan and heparin metabolism pathway is involved in regulation of fatty acid composition.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15226404 2004 Stem domains of heparan sulfate 6-O-sulfotransferase are required for Golgi localization, oligomer formation and enzyme activity.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...