Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.19
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-03
aldosterone-producing adenoma 1.332 1.3e-02
astrocytic glioma -2.500 2.6e-03
Astrocytoma, Pilocytic -2.000 1.7e-05
atypical teratoid / rhabdoid tumor -3.200 5.3e-06
Breast cancer 1.400 9.2e-04
ependymoma -2.700 4.3e-03
glioblastoma -3.200 2.5e-11
group 3 medulloblastoma -2.100 9.3e-03
medulloblastoma, large-cell -4.400 4.8e-05
oligodendroglioma -2.200 1.1e-02
ovarian cancer -1.900 9.3e-06
Pick disease -1.500 3.3e-03
primitive neuroectodermal tumor -2.600 7.9e-03
psoriasis -1.300 2.8e-21

Gene RIF (3)

AA Sequence

MDERFNKWLLTPVLTLLFVVIMYQYVSPSCTSSCTNFGEQPRAGEAGPPAVPGPARRAQAPPEEWERRPQ      1 - 70
LPPPPRGPPEGPRGAAAPEEEDEEPGDPREGEEEEEEDEPDPEAPENGSLPRFVPRFNFSLKDLTRFVDF     71 - 140
NIKGRDVIVFLHIQKTGGTTFGRHLVKNIRLEQPCSCKAGQKKCTCHRPGKKETWLFSRFSTGWSCGLHA    141 - 210
DWTELTNCVPAIMEKKDCPRNHSHTRNFYYITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDE    211 - 280
LPTCYPGDDWSGVSLREFMDCTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAF    281 - 350
FGLTEFQRKTQFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYAKDLFQQRYH    351 - 420
HTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW                       421 - 471
//

Text Mined References (14)

PMID Year Title