Property Summary

NCBI Gene PubMed Count 5
PubMed Score 82.31
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGTATQKAKSEENTKEEKPDSKVEEDLKADEP      1 - 70
SSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLN     71 - 140
PRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKRRGKAHRLLGHWEEAAHDLALACKFDYD    141 - 210
EDASAMLKEVQPRAQKIAEHQRKYERKREE                                            211 - 240
//

Text Mined References (6)

PMID Year Title