Property Summary

NCBI Gene PubMed Count 5
PubMed Score 75.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
12079276 establishement of conditions to specifically undertake mutation studies of this chromosome 13 member

AA Sequence

MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGTATQKAKSEENTKEEKPDSKVEEDLKADEP      1 - 70
SSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLN     71 - 140
PRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKRRGKAHRLLGHWEEAAHDLALACKFDYD    141 - 210
EDASAMLKEVQPRAQKIAEHQRKYERKREE                                            211 - 240
//

Text Mined References (6)

PMID Year Title
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12079276 2002 Characterization of FAM10A4, a member of the ST13 tumor suppressor gene family that maps to the 13q14.3 region associated with B-Cell leukemia, multiple myeloma, and prostate cancer.