Property Summary

NCBI Gene PubMed Count 71
PubMed Score 104.15
PubTator Score 97.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GWAS Trait (1)

Gene RIF (39)

AA Sequence

MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN      1 - 70
NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP     71 - 140
IDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVP    141 - 210
NDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPP    211 - 280
PSGAPPAPPLAPLLPVSTVIAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVN    281 - 350
GGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD    351 - 420
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNR    421 - 490
VTGLFPGNYVESIMHYTD                                                        491 - 508
//

Text Mined References (83)

PMID Year Title