Property Summary

NCBI Gene PubMed Count 68
Grant Count 43
R01 Count 34
Funding $2,536,609.35
PubMed Score 102.60
PubTator Score 97.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26193797 Suggest that Abi1 acts as a tumor-promoting gene in epithelial ovarian cancer progression, which may lead to unfavorable prognosis.
24913355 Our data indicate that phosphorylated Abi1 contributes to the invasive properties of colorectal cancer.
24699303 These results indicate that the alpha4-Abi-1 signaling pathway may mediate acquisition of the drug-resistant phenotype of leukemic cells.
24196611 Abi1 is expressed at the invasive front of colorectal carcinomas and localizes to the leading edge of lamellipodia in cultured colorectal carcinoma cells.
23740246 Data indicate that Abi1 is activated by the c-Abl-Crk-associated substrate (CAS) pathway, and Abi1 reciprocally controls the activation of its upstream regulator c-Abl.
22808230 a possible role for Abi1 as a marker for early KRAS mutation in hyperplastic polyps
22430194 Down-regulation of E3B1/ABI-1 expression in human carcinomas may play a critical role in tumor progression and in determining disease prognosis.
22014333 The phosphorylation and dephosphorylation cycle of VASP by the Abi-1-bridged mechanism regulates association of VASP with focal adhesions, which may regulate adhesion of Bcr-Abl-transformed leukaemic cells.
21900237 CDK1-mediated phosphorylation of Abi1 attenuates Bcr-Abl-induced F-actin assembly and tyrosine phosphorylation of WAVE complex during mitosis
21320496 Data show that disruption of phosphorylation sits Y398 and Y213 significantly weakens the binding of Abi-1 to c-Abl.
More...

AA Sequence

MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN      1 - 70
NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP     71 - 140
IDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVP    141 - 210
NDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPP    211 - 280
PSGAPPAPPLAPLLPVSTVIAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVN    281 - 350
GGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD    351 - 420
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNR    421 - 490
VTGLFPGNYVESIMHYTD                                                        491 - 508
//

Text Mined References (80)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26193797 2015 Upregulation of Abelson interactor protein 1 predicts tumor progression and poor outcome in epithelial ovarian cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25121749 2014 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells.
24913355 2014 Expression and Y435-phosphorylation of Abelson interactor 1 (Abi1) promotes tumour cell adhesion, extracellular matrix degradation and invasion by colorectal carcinoma cells.
24699303 2014 Low expression of Abelson interactor-1 is linked to acquired drug resistance in Bcr-Abl-induced leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196611 2013 [Abelson interactor 1 (Abi1) in colorectal cancer. From synaptic plasticity to tumor cell migration].
23740246 2013 Role of the adapter protein Abi1 in actin-associated signaling and smooth muscle contraction.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...