Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MPGAMKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH      1 - 70
//

Text Mined References (10)

PMID Year Title