Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.28
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-04
atypical teratoid / rhabdoid tumor -1.900 5.0e-08
ependymoma -1.100 7.9e-04
glioblastoma -1.500 1.3e-04
group 3 medulloblastoma -1.600 6.6e-06
lung cancer -1.400 1.5e-03
medulloblastoma, large-cell -2.000 1.6e-06
osteosarcoma -1.698 1.1e-05
ovarian cancer -1.300 1.6e-04
Pick disease 1.200 1.8e-06
primitive neuroectodermal tumor -1.200 3.9e-05
progressive supranuclear palsy 1.100 4.0e-02

Gene RIF (2)

AA Sequence

MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQTGVFYLTLVL      1 - 70
ILVTSGLFFAFDCPYLAVKITPAIPAVAGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANG     71 - 140
TSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFF    141 - 210
YMFILSLSFLTVFIFAFVITHVILRSQQTGFLNALKDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQ    211 - 280
TTNEDIKGSWSNKRGKENYNPYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGAT    281 - 350
QSQSDMCDQDQCIQSTKFVLQAAATPLLQSEPSLTSDELHLPGKPGLGTPCASLTLGPPTPPASMPNLAE    351 - 420
ATLADVMPRKDEHMGHQFLTPDEAPSPPRLLAAGSPLAHSRTMHVLGLASQDSLHEDSVRGLVKLSSV      421 - 488
//

Text Mined References (12)

PMID Year Title