Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.08
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.698 0.000
ependymoma -1.100 0.001
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.500 0.001
lung cancer -1.600 0.000
pediatric high grade glioma -1.200 0.000
Pick disease 1.200 0.000
progressive supranuclear palsy 1.100 0.040
ovarian cancer -1.300 0.000

Synonym

Accession Q8IZN3 A6NDB7 Q5JS07 Q5JS08 Q6PHS4 Q8IZN2 Q9H7F1
Symbols NEW1CP

Gene

Gene RIF (2)

PMID Text
24807047 Results indicate that ZDHHC14 is involved in tumor progression in patients with scirrhous type gastric cancer.
24407904 Identify ZDHHC14 as a novel tumour suppressor gene that is commonly down-regulated in testicular germ cell tumours and prostate cancer.

AA Sequence

MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQTGVFYLTLVL      1 - 70
ILVTSGLFFAFDCPYLAVKITPAIPAVAGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANG     71 - 140
TSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFF    141 - 210
YMFILSLSFLTVFIFAFVITHVILRSQQTGFLNALKDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQ    211 - 280
TTNEDIKGSWSNKRGKENYNPYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGAT    281 - 350
QSQSDMCDQDQCIQSTKFVLQAAATPLLQSEPSLTSDELHLPGKPGLGTPCASLTLGPPTPPASMPNLAE    351 - 420
ATLADVMPRKDEHMGHQFLTPDEAPSPPRLLAAGSPLAHSRTMHVLGLASQDSLHEDSVRGLVKLSSV      421 - 488
//

Text Mined References (12)

PMID Year Title
24807047 2014 Overexpression of ZDHHC14 promotes migration and invasion of scirrhous type gastric cancer.
24407904 2014 Identification of ZDHHC14 as a novel human tumour suppressor gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...