Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.62
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24752331 SLC38A6 is primarily expressed in excitatory neurons and is not expressed in the astrocytes.
18976975 Knockdown of solute carrier family 38, member 6 (SLC38A6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEASWGSFNAERGWYVSVQQPEEAEAEELSPLLSNELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVL      1 - 70
ANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYL     71 - 140
LIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVI    141 - 210
IKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKR    211 - 280
MQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFP    281 - 350
ARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSR    351 - 420
EDFLSWKKLGAFVLLIFGILVGNFSLALIIFDWINK                                      421 - 456
//

Text Mined References (12)

PMID Year Title
24752331 2014 Histological analysis of SLC38A6 (SNAT6) expression in mouse brain shows selective expression in excitatory neurons with high expression in the synapses.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12845534 2004 Sodium-coupled neutral amino acid (System N/A) transporters of the SLC38 gene family.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...