Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.62
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.100 3.3e-02
adult high grade glioma 1.200 3.4e-04
Astrocytoma, Pilocytic 1.200 3.7e-05
chronic rhinosinusitis -1.032 8.5e-03
ependymoma 1.600 7.6e-12
glioblastoma 1.200 1.2e-04
intraductal papillary-mucinous neoplasm ... 1.300 7.8e-03
lung cancer 1.300 1.6e-03
ovarian cancer -1.500 1.9e-04
subependymal giant cell astrocytoma 2.889 5.4e-03

Gene RIF (2)

AA Sequence

MEASWGSFNAERGWYVSVQQPEEAEAEELSPLLSNELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVL      1 - 70
ANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYL     71 - 140
LIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVI    141 - 210
IKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKR    211 - 280
MQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFP    281 - 350
ARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSR    351 - 420
EDFLSWKKLGAFVLLIFGILVGNFSLALIIFDWINK                                      421 - 456
//

Text Mined References (12)

PMID Year Title