Property Summary

NCBI Gene PubMed Count 2
PubMed Score 266.80
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.81615268012177E-5
medulloblastoma, large-cell 6234 9.28148374947226E-4
atypical teratoid / rhabdoid tumor 4369 0.00461727852977081

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.903 0.000
atypical teratoid / rhabdoid tumor -1.100 0.005
medulloblastoma, large-cell -1.200 0.001

Synonym

Accession Q8IZM8 Q9H791 Q9NV14
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

AA Sequence

MLCNKEFLGGHIVRHAQAHQKKGSFACVICGRKFRNRGLMQKHLKNHVKKIQRQQIAAAQQDDQEVTALE      1 - 70
EINCSSSSISFENGNSDSKDLEVETLTASSEGNKEVIPEHVAEFIEIPISVPEDVIENVIENGSPNNSLN     71 - 140
NVFKPLTECGDDYEEEEDEEGDYEEDDYDLNQETSVIHKINGTVCHPKDIYATDQEGNFKCPALGCVRIF    141 - 210
KRIGFLNKHAMTVHPTDLNVRQTVMKWSKGKCKFCQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFK    211 - 280
LPFQLAQHTKSHRIFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPESSAQPSETILWDVQTDSNPNQE    281 - 350
KDSSSNEKQTISLPVSTSKSRKESTEPKTCIESMEKKTDSLVQNGNERSDDTVSNISLIDQKMPDIEPNS    351 - 420
ENNCSSSDIVNGHSEIEQTPLVSSDPALKIDTNRIRTENGSILPSVVPQEHNTLPVSQAPSKPNLTSEHT    421 - 490
SYGLILTKPYVRPLPPSYLDERYLSMPKRRKFLTDRVDACSDQDNVYKKSVKRLRCGKCLTTYCNAEALE    491 - 560
AHLAQKKCQTLFGFDSDDESA                                                     561 - 581
//

Text Mined References (3)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.