Knowledge Summary

Patent

No data available

Synonym

Accession Q8IZM0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MDSYSAKIRANLVCRRSTDPSIRVTFSSRSLGSLPAFAMFRSSRPSFIKICFPFSSSIVLASGYSVRASM      1 - 70
RSSFERQNRSE                                                                71 - 81
//

Text Mined References (1)

PMID Year Title
12388767 2002 An endogenous RNA transcript antisense to CNG(alpha)1 cation channel mRNA.