Property Summary

NCBI Gene PubMed Count 18
PubMed Score 61.49
PubTator Score 352.28

Knowledge Summary

Patent (26,745)

TINX Plot

  Disease Sources (2)

Disease Target Count
Alcoholic Intoxication, Chronic 41
Disease Target Count P-value
malignant mesothelioma 3163 4.10576442988264E-6
psoriasis 6685 0.00104142668994753
medulloblastoma, large-cell 6234 0.00415033723693708

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -1.400 0.001
medulloblastoma, large-cell -1.100 0.004

Synonym

Accession Q8IZL9 A2A389 A2A390 B4DQX1 O95137 Q5EDC4 Q5VYW1 Q9BUF4
Symbols P42
CCRK
CDCH
PNQALRE

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (8)

PMID Text
25500144 A CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patient.
23743448 In glioblastoma cells with deregulated high levels of CCRK, its depletion restores cilia through ICK and an ICK-related kinase MAK, thereby inhibiting glioblastoma cell proliferation.
22875024 Data indicate that expression of ERAS, LHX1, and CCRK is increased in aggressive subgroups of medulloblastomas.
21747169 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives beta-catenin/T cell factor-dependent hepatocarcinogenesis
20466538 results suggest for the first time that CCRK is involved in colorectal cancer carcinogenesis and G1/S cell cycle transition by regulating Cdk2, cyclin E and Rb.
19672860 Overexpression of CCRK is associated with ovarian carcinoma.
16552187 Depletion of PNQALRE by >80% due to RNA interference (RNAi) impairs cell proliferation, but fails to arrest the cell cycle at a discrete point.
14597612 identification of p42, a novel cyclin-dependent kinase-activating kinase (CAK) activity in human cells; p42 is essential for the phosphorylation of Thr-160 and activation of CDK2 and is indispensable for cell growth

AA Sequence

MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAV      1 - 70
FPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQ     71 - 140
LKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDI    141 - 210
EQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAAS    211 - 280
KALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG        281 - 346
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25500144 2015 A CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patients.
23743448 2013 CCRK depletion inhibits glioblastoma cell proliferation in a cilium-dependent manner.
22875024 2012 Functional genomics identifies drivers of medulloblastoma dissemination.
21986944 2012 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/CCDH1.
21747169 2011 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives ?-catenin/T cell factor-dependent hepatocarcinogenesis.
20466538 2010 Functional characterisation of cell cycle-related kinase (CCRK) in colorectal cancer carcinogenesis.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19672860 2009 Cell cycle-related kinase supports ovarian carcinoma cell proliferation via regulation of cyclin D1 and is a predictor of outcome in patients with ovarian carcinoma.
18508765 2008 Characterization of a novel cardiac isoform of the cell cycle-related kinase that is regulated during heart failure.
More...