Property Summary

NCBI Gene PubMed Count 18
PubMed Score 67.70
PubTator Score 352.28

Knowledge Summary

Patent (26,745)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Alcoholism 45 0.0 0.0
Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
malignant mesothelioma 3232 4.1e-06
psoriasis 6694 1.0e-03
medulloblastoma, large-cell 6241 4.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 4.1e-06
medulloblastoma, large-cell -1.100 4.2e-03
psoriasis -1.400 1.0e-03

Gene RIF (8)

AA Sequence

MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAV      1 - 70
FPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQ     71 - 140
LKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDI    141 - 210
EQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAAS    211 - 280
KALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG        281 - 346
//

Text Mined References (20)

PMID Year Title