Property Summary

NCBI Gene PubMed Count 58
PubMed Score 72.44
PubTator Score 66.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.100 3.9e-03
aldosterone-producing adenoma -1.053 2.4e-02
astrocytic glioma 1.800 5.8e-03
Astrocytoma, Pilocytic 1.200 1.8e-05
atypical teratoid / rhabdoid tumor 1.800 1.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.167 1.0e-03
Breast cancer 2.200 4.0e-02
breast carcinoma -1.900 9.8e-45
ductal carcinoma in situ -1.500 2.4e-03
ependymoma 1.900 5.9e-03
glioblastoma 1.100 1.1e-04
group 3 medulloblastoma 2.400 9.8e-04
invasive ductal carcinoma -1.900 2.5e-03
juvenile dermatomyositis 1.291 1.6e-12
medulloblastoma, large-cell 1.300 1.2e-03
oligodendroglioma 2.000 1.1e-02
ovarian cancer 1.700 2.1e-05
pancreatic cancer 1.500 4.6e-04
Pick disease 1.700 6.7e-04
primary pancreatic ductal adenocarcinoma 1.388 5.5e-04
primitive neuroectodermal tumor 1.100 1.4e-02
psoriasis -1.300 2.6e-31

Protein-protein Interaction (4)

Gene RIF (45)

AA Sequence

MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRER      1 - 70
ESTLQLLSLVQHGQGARKAGKHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLN     71 - 140
SSNNGGSGGINGEQQPPASTPGDQRNSALIALQGSLKRKQVVNLSPANSKRPNGFVDNSFLDIKRIRVGE    141 - 210
NLSAGQGGLQINNGQSQIMSGTLPMSQAPLRKTNTLPSHTHSPGNGLFNMGLKEVKKEPGETLSCSKHMD    211 - 280
GQMTQENIFPNRYGDDPGEQLMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQR    281 - 350
STPRPSLPMEKIVIKSEYSPGLTQGPSGSPQLRPPSAGPAFSMANSALSTSSPIPSVPQSQAQPQTGSGA    351 - 420
SRALPSWQEVSHAQQLKQIAANRQQHARMQQHQQQHQPTNWSALPSSAGPSPGPFGQEKIPSPSFGQQTF    421 - 490
SPQSSPMPGVAGGSGQSKVMANYMYKAGPSAQGGHLDVLMQQKPQDLSRSFINNPHPAMEPRQGNTKPLF    491 - 560
HFNSDQANQQMPSVLPSQNKPSLLHYTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSISAQQQQ    561 - 630
QQQSSISAQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQPAQSLPSQPLLRSPLPLQQKLLLQQMQNQPI    631 - 700
AGMGYQVSQQQRQDQHSVVGQNTGPSPSPNPCSNPNTGSGYMNSQQSLLNQQLMGKKQTLQRQIMEQKQQ    701 - 770
LLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHT    771 - 840
ILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQRNPKQLLANQNNPMMPR    841 - 910
PPTLGPSNNNNVATFGAGSVGNSQQLRPNLTHSMASMPPQRTSNVMITSNTTAPNWASQEGTSKQQEALT    911 - 980
SAGVRFPTGTPAAYTPNQSLQQAVGSQQFSQRAVAPPNQLTPAVQMRPMNQMSQTLNGQTMGPLRGLNLR    981 - 1050
PNQLSTQILPNLNQSGTGLNQSRTGINQPPSLTPSNFPSPNQSSRAFQGTDHSSDLAFDFLSQQNDNMGP   1051 - 1120
ALNSDADFIDSLLKTEPGNDDWMKDINLDEILGNNS                                     1121 - 1156
//

Text Mined References (62)

PMID Year Title