Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MLFIRMLRRAGQSPACGCWTPVLPVRFLGISPRQIPADANFHSASFSDTDHPRVLITGALGQLGVGLANL      1 - 70
LRKRFGKDSVILSDIRKPPDHVFHSGPFIYSDILDYKNLREIVVNNRITWLFHYSALLSAFGEANVSLAR     71 - 140
AVNITGLHNILDVAAEHNLQLFVPSTIGAFGPTSPRNPTPDLCIQRPRTIYGVSKVHAELMGETMQSRFS    141 - 210
MMPQSMANSSATWKPARDCP                                                      211 - 230
//

Text Mined References (6)

PMID Year Title