Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
12361482 The human L-threonine 3-dehydrogenase gene is an expressed pseudogene having lost the splice acceptor site preceding exon 6 and codon arginine-214 (CGA) is mutated to a stop codon (TGA)

AA Sequence

MLFIRMLRRAGQSPACGCWTPVLPVRFLGISPRQIPADANFHSASFSDTDHPRVLITGALGQLGVGLANL      1 - 70
LRKRFGKDSVILSDIRKPPDHVFHSGPFIYSDILDYKNLREIVVNNRITWLFHYSALLSAFGEANVSLAR     71 - 140
AVNITGLHNILDVAAEHNLQLFVPSTIGAFGPTSPRNPTPDLCIQRPRTIYGVSKVHAELMGETMQSRFS    141 - 210
MMPQSMANSSATWKPARDCP                                                      211 - 230
//

Text Mined References (6)

PMID Year Title
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12361482 2002 The human L-threonine 3-dehydrogenase gene is an expressed pseudogene.
11896452 2002 Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759.