Property Summary

NCBI Gene PubMed Count 38
PubMed Score 48.35
PubTator Score 36.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 1.2e-02
Breast cancer 1.400 1.5e-06
breast carcinoma 1.500 4.5e-03
ductal carcinoma in situ 1.700 1.1e-03
interstitial cystitis -1.200 1.9e-03
invasive ductal carcinoma 1.601 7.8e-04
osteosarcoma 1.497 1.6e-02
ovarian cancer 1.200 2.6e-03
pancreatic cancer 1.500 6.2e-03
Polycystic ovary syndrome -1.491 6.4e-03
primary pancreatic ductal adenocarcinoma 1.709 9.2e-04
psoriasis 1.600 3.9e-04
ulcerative colitis -1.400 2.3e-05
X-linked cerebral adrenoleukodystrophy 1.200 2.4e-02

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCR      1 - 70
AFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTK     71 - 140
SRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNL    141 - 210
IIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLN    211 - 280
GGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTD    281 - 350
GLCMQNKKTLSDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG    351 - 420
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSLKVKVYSSSTT    421 - 490
GSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPG    491 - 560
TGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSA    561 - 630
RDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVF    631 - 700
APALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKL    701 - 770
LAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC    771 - 840
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLW    841 - 910
EALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC                                       911 - 945
//

Text Mined References (41)

PMID Year Title