Property Summary

NCBI Gene PubMed Count 36
Grant Count 18
R01 Count 16
Funding $1,505,080.14
PubMed Score 46.24
PubTator Score 36.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (23)

PMID Text
24584118 unc5b expression is greater in adipose tissue of obese versus lean subjects.
24528886 UNC5B expression is decreased in bladder cancer cells compared to normal bladder cell lines.
24122613 Data indicate that dysregulation of expression of netrin-1 NTN1 in smooth muscle cell (SMC) and its chemorepulsive receptor UNC5B in macrophages are involved in the development of atherosclerosis and unstable plaques.
23666553 Higher netrin-1 and lower UNC5B expression in all prostate carcinoma cell lines indicated that netrin-1 and UNC5B could be used to predict metastasis.
23599441 UNC5B protein expressed in macrophages in hypoxic regions of atherosclerotic regions in human.
23526078 UNC5B was downregulated in kidney carcinoma.
23312517 Reducing Unc5b levels in Sip1 knockout slices and brains rescues cell migration in cortical interneurons.
23055195 Low UNC5B expression was an independent risk factor for postoperative recurrence in patients with different stages and grades bladder cancer.
22252496 Hypoxia-inducible factor 1 controls the expression of the uncoordinated-5-B receptor, but not of netrin-1, in first trimester human placenta
21922135 The mRNA expression analysis using tissue samples revealed that UNC5B mRNA was down-expressed in about 20% of CRC patients, and the patients with low-UNC5B-expression tumors showed a significantly higher recurrence rate after curative surgery.
More...

AA Sequence

MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCR      1 - 70
AFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTK     71 - 140
SRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNL    141 - 210
IIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLN    211 - 280
GGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTD    281 - 350
GLCMQNKKTLSDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG    351 - 420
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSLKVKVYSSSTT    421 - 490
GSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPG    491 - 560
TGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSA    561 - 630
RDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVF    631 - 700
APALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKL    701 - 770
LAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC    771 - 840
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLW    841 - 910
EALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC                                       911 - 945
//

Text Mined References (39)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
25374360 2014 FLRT structure: balancing repulsion and cell adhesion in cortical and vascular development.
24584118 2014 Netrin-1 promotes adipose tissue macrophage retention and insulin resistance in obesity.
24528886 2014 PKC ? regulates netrin-1/UNC5B-mediated survival pathway in bladder cancer.
24122613 2013 Association of neuroimmune guidance cue netrin-1 and its chemorepulsive receptor UNC5B with atherosclerotic plaque expression signatures and stability in human(s): Tampere Vascular Study (TVS).
23666553 2013 Interactional expression of netrin-1 and its dependence receptor UNC5B in prostate carcinoma.
23599441 2013 Hypoxia induces netrin-1 and Unc5b in atherosclerotic plaques: mechanism for macrophage retention and survival.
23526078 2013 PKC? is involved in the progression of kidney carcinoma through regulating netrin-1/UNC5B signaling pathway.
23312517 2013 Directed migration of cortical interneurons depends on the cell-autonomous action of Sip1.
More...