Property Summary

NCBI Gene PubMed Count 33
PubMed Score 36.95
PubTator Score 10.73

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (29)

AA Sequence

MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLL      1 - 70
KDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRAC     71 - 140
IQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV              141 - 200
//

Text Mined References (36)

PMID Year Title