Property Summary

NCBI Gene PubMed Count 33
Grant Count 13
R01 Count 4
Funding $676,542.14
PubMed Score 33.68
PubTator Score 10.73

Knowledge Summary

Patent

No data available

Gene RIF (29)

PMID Text
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
25355870 These results show that type III interferons (IFN-lambdas) play a critical protective role in human metapneumovirus infection.
24973639 this study provides evidence for potential IL-28A participation in Behcet's diseaseand its value as a therapeutic agent.
24385435 Interferon regulatory factor (IRF)-3 and -7 are the key transcriptional factors for the induction of IL-28A and IL-28B genes, whereas NF-kappaB is an additional requirement for the induction of the IL-29 gene.
24269996 Results showed no association between genotypes and alleles of IL28A, IL28B or IL29 polymorphisms and Hepatitis C virus infection.
23652058 IL-28 genotype was not associated with response to interferon treatment (OR for GT/GG vs. TT, 0.881 (95%CI 0.388 - 2.002); P = 0.762; OR for CT/CC vs. TT, 0.902 (95%CI 0.458 - 1.778); P = 0.766).
23207147 IFN-lambdas can also directly affect T cells through inhibition of the T helper 2 cell (Th2) responses. IFN-lambdas have varying immunomodulatory functions under different physiological conditions
22962576 Elevated expression of inflammatory cytokines (IL-5, IL-20, and IL-28A) is associated with bladder cancer development.
22891284 Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation.
More...

AA Sequence

MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLL      1 - 70
KDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRAC     71 - 140
IQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV              141 - 200
//

Text Mined References (36)

PMID Year Title
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
25355870 2015 Impact and regulation of lambda interferon response in human metapneumovirus infection.
24973639 2014 Interleukin-28A promotes IFN-? production by peripheral blood mononuclear cells from patients with Behçet's disease.
24751921 2014 Interferon-? in the context of viral infections: production, response and therapeutic implications.
24385435 2014 Transcriptional regulation of IFN-? genes in hepatitis C virus-infected hepatocytes via IRF-3·IRF-7·NF-?B complex.
24269996 2014 Genetic polymorphisms of the IFN? genes are associated with biochemical features in Han Chinese with HCV infection from Yunnan Province, China.
23652058 2013 Gene polymorphisms of interleukin-28, p21-activated protein kinases 4, and response to interferon-? based therapy in Chinese patients with chronic hepatitis B.
23207147 2013 Interferon-?s: special immunomodulatory agents and potential therapeutic targets.
22962576 2012 Identification of pro-inflammatory cytokines associated with muscle invasive bladder cancer; the roles of IL-5, IL-20, and IL-28A.
More...