Property Summary

NCBI Gene PubMed Count 455
Grant Count 84
R01 Count 30
Funding $15,854,395.17
PubMed Score 1189.71
PubTator Score 1119.11

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IZI9 A2BDE1 Q6VN56 Q7Z4J3 Q8IWL6 IFN-lambda-3
Symbols IL28B
IL28C
IL-28B
IL-28C
IFN-lambda-3
IFN-lambda-4

Gene

PDB

3HHC  

Gene RIF (464)

PMID Text
27522730 Combination of blood group specificity and interleukin 28B gene polymorphism is a simple and reliable predictor of sustained virologic response and dynamics of fibrosis.
27156332 significant effects of IL-28B G allele carriers on susceptibility to HCV infection com-pared to the other allele (T).
27100663 IL28B polymorphism is associated with response to therapy in HCV Genotype 4.
27058339 The rate of CC allele in IL-28B rs12979860 gene was the highest in immune subjects, while it was the lowest in chronic hepatitis B patients. IL-28B rs12979860 gene polymorphisms were not effective on the clinical course of HBV infection
26911666 Vitamin D related (VDR rs2228570 and CYP2R1 rs10741657) and IL28B rs12979860 genes polymorphisms accurately assure sustained viral response in naive CHC G4 patients treated with low cost standard therapy.
26896692 that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling, leading to impaired HCV clearance by both IFN-alpha and IFN-lambda
26741362 The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico.
26732192 Core aa70 mutation and the IL28B non-TT genotype were identified as independent factors that influenced relapse after achievement of ETR for telaprevir-based triple therapy.
26699619 IFNL3 SNPs were associated with virological response in patients with chronic hepatitis C.
26670100 The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes.
More...

AA Sequence

MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCK      1 - 70
CRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQ     71 - 140
PTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV                  141 - 196
//

Text Mined References (459)

PMID Year Title
27522730 2016 [PROGNOSTIC VALUE OF THE COMBINATION OF BLOOD GROUP SPECIFICITY AND INTERLEUKIN 28B GENE POLYMORPHISM FOR ESTIMATION OF EFFICIENCY OF THERAPY WITH THE USE OF PEGYLATED INTERFERON ?-2 AND RIBAVARIN IN PATIENTS WITH CHRONIC GENOTYPE 1 HEPATITIS C].
27156332 2016 Correlation Study Between IL-28B Gene Polymorphism (rs8099917SNP) and Sustained Virological Response in Iranian Patients with Chronic Hepatitis C.
27100663 2016 Pretreatment Predictors of Response to PegIFN-RBV Therapy in Egyptian Patients with HCV Genotype 4.
27058339 2016 [Effect of IL-28B polymorphisms on the natural course of HBV infection].
26911666 2016 Integrative role of vitamin D related and Interleukin-28B genes polymorphism in predicting treatment outcomes of Chronic Hepatitis C.
26896692 2016 Cellular Mechanism for Impaired Hepatitis C Virus Clearance by Interferon Associated with IFNL3 Gene Polymorphisms Relates to Intrahepatic Interferon-? Expression.
26741362 2016 Association with Spontaneous Hepatitis C Viral Clearance and Genetic Differentiation of IL28B/IFNL4 Haplotypes in Populations from Mexico.
26732192 Evaluation of factors associated with relapse in telaprevir-based triple therapy for chronic hepatitis C.
26699619 2015 Performance and Value of IFN-Lambda3 and IFN-Lambda4 Genotyping in Patients with Chronic Hepatitis C (CHC) Genotype 2/3 in a Real World Setting.
26670100 2015 Impact of IL28B, APOH and ITPA Polymorphisms on Efficacy and Safety of TVR- or BOC-Based Triple Therapy in Treatment-Experienced HCV-1 Patients with Compensated Cirrhosis from the ANRS CO20-CUPIC Study.
More...