Property Summary

NCBI Gene PubMed Count 493
PubMed Score 1258.99
PubTator Score 1119.11

Knowledge Summary

Patent

No data available

Gene RIF (502)

AA Sequence

MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCK      1 - 70
CRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQ     71 - 140
PTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV                  141 - 196
//

Text Mined References (497)

PMID Year Title