Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.85
PubTator Score 2.38

Knowledge Summary

Patent (1,471)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung cancer 4,466 1.0

Expression

Gene RIF (1)

PMID Text
24114056 Overexpression of GPR113 is associated with Small bowel primary and metastatic neuroendocrine tumors.

AA Sequence

MVCSAAPLLLLATTLPLLGSPVAQASQPVSETGVRPREGLQRRQWGPLIGRDKAWNERIDRPFPACPIPL      1 - 70
SSSFGRWPKGQTMWAQTSTLTLTEEELGQSQAGGESGSGQLLDQENGAGESALVSVYVHLDFPDKTWPPE     71 - 140
LSRTLTLPAASASSSPRPLLTGLRLTTECNVNHKGNFYCACLSGYQWNTSICLHYPPCQSLHNHQPCGCL    141 - 210
VFSHPEPGYCQLLPPGSPVTCLPAVPGILNLNSQLQMPGDTLSLTLHLSQEATNLSWFLRHPGSPSPILL    211 - 280
QPGTQVSVTSSHGQAALSVSNMSHHWAGEYMSCFEAQGFKWNLYEVVRVPLKATDVARLPYQLSISCATS    281 - 350
PGFQLSCCIPSTNLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYACDLQSLGLAPLRVPIS    351 - 420
ITIIQDGDITCPEDASVLTWNVTKAGHVAQAPCPESKRGIVRRLCGADGVWGPVHSSCTDARLLALFTRT    421 - 490
KLLQAGQGSPAEEVPQILAQLPGQAAEASSPSDLLTLLSTMKYVAKVVAEARIQLDRRALKNLLIATDKV    491 - 560
LDMDTRSLWTLAQARKPWAGSTLLLAVETLACSLCPQDHPFAFSLPNVLLQSQLFGPTFPADYSISFPTR    561 - 630
PPLQAQIPRHSLAPLVRNGTEISITSLVLRKLDHLLPSNYGQGLGDSLYATPGLVLVISIMAGDRAFSQG    631 - 700
EVIMDFGNTDGSPHCVFWDHSLFQGRGGWSKEGCQAQVASASPTAQCLCQHLTAFSVLMSPHTVPEEPAL    701 - 770
ALLTQVGLGASILALLVCLGVYWLVWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFLSPGPRSPL    771 - 840
CLAAAFLCHFLYLATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLGYLCPLGLAGVTLGLYLPQGQ    841 - 910
YLREGECWLDGKGGALYTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGPPAEKRQALLGVIKALLILTP    911 - 980
IFGLTWGLGLATLLEEVSTVPHYIFTILNTLQGVFILLFGCLMDRKIQEALRKRFCRAQAPSSTISLVSC    981 - 1050
CLQILSCASKSMSEGIPWPSSEDMGTARS                                            1051 - 1079
//

Text Mined References (10)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435584 2002 Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.