Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.82
PubTator Score 1.92

Knowledge Summary

Patent (750)


  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.0e-26
interstitial cystitis 2312 8.6e-03
pulmonary arterial hypertension 76 3.9e-02


  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.600 8.6e-03
psoriasis 1.100 3.0e-26
pulmonary arterial hypertension -1.500 3.9e-02

Gene RIF (1)

AA Sequence

LNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ                                    491 - 528

Text Mined References (11)

PMID Year Title