Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.82
PubTator Score 1.92

Knowledge Summary

Patent (750)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.600 0.009
pulmonary arterial hypertension -1.500 0.039
psoriasis 1.100 0.000

Gene RIF (1)

PMID Text
20600896 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDHCGALFLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQT      1 - 70
PTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTH     71 - 140
FFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCR    141 - 210
TEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSL    211 - 280
TRIHMNLHASVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIY    281 - 350
IRRYVFKLGVLGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYG    351 - 420
GLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLGLTVLLGTTWALAFFSFGVFLLPQLFLFTI    421 - 490
LNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ                                    491 - 528
//

Text Mined References (11)

PMID Year Title
26499266 2016 The constitutive activity of the adhesion GPCR GPR114/ADGRG5 is mediated by its tethered agonist.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
21724806 2011 Specific expression of GPR56 by human cytotoxic lymphocytes.
20600896 2010 Genome-wide association study of vitamin D concentrations in Hispanic Americans: the IRAS family study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...