Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.82
PubTator Score 1.92

Knowledge Summary

Patent (750)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.00351897831731E-26
interstitial cystitis 2299 0.00859756786109382
pulmonary arterial hypertension 36 0.0392657551539021

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.600 0.009
pulmonary arterial hypertension -1.500 0.039
psoriasis 1.100 0.000

Synonym

Accession Q8IZF4 A0A024R6S3 A8K9R8 B3KXZ5 Q6ZMH7 Q6ZML4 Q86SL8 Q8IZ14
Symbols PGR27
GPR114

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG

Gene RIF (1)

PMID Text
20600896 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDHCGALFLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQT      1 - 70
PTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTH     71 - 140
FFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCR    141 - 210
TEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSL    211 - 280
TRIHMNLHASVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIY    281 - 350
IRRYVFKLGVLGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYG    351 - 420
GLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLGLTVLLGTTWALAFFSFGVFLLPQLFLFTI    421 - 490
LNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ                                    491 - 528
//

Text Mined References (11)

PMID Year Title
26499266 2016 The constitutive activity of the adhesion GPCR GPR114/ADGRG5 is mediated by its tethered agonist.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
21724806 2011 Specific expression of GPR56 by human cytotoxic lymphocytes.
20600896 2010 Genome-wide association study of vitamin D concentrations in Hispanic Americans: the IRAS family study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...