Property Summary

NCBI Gene PubMed Count 23
PubMed Score 42.74
PubTator Score 22.14

Knowledge Summary

Patent (3,662)

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
psoriasis 6685 1.15662068244301E-33
lung carcinoma 2844 4.10472158386977E-31
Breast cancer 3099 1.17618193500974E-20
atypical teratoid / rhabdoid tumor 4369 1.14763965758602E-8
medulloblastoma, large-cell 6234 1.61995868270802E-7
pediatric high grade glioma 2712 7.16127139531483E-5
interstitial cystitis 2299 7.69222358662462E-5
group 3 medulloblastoma 2254 8.80291396699649E-5
ependymoma 2514 1.56516827575507E-4
glioblastoma 5572 2.82463489443238E-4
ovarian cancer 8492 4.3053524662147E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00156907870804244
primitive neuroectodermal tumor 3031 0.0017178531958414
Pick disease 1893 0.00460491103114031
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00944278811435593
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0228026306612189
osteosarcoma 7933 0.0231659644773389
subependymal giant cell astrocytoma 2287 0.0331663169044487
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Dementia 129 0.0 1.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

Synonym

Accession Q8IZF0 Q6P2S6 Q6ZMI7 Q8IZZ1 Q8TAH1
Symbols IHPRF
INNFD
CanIon
IHPRF1
VGCNL1
CLIFAHDD
bA430M15.1

Gene

  Ortholog (13)

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (13)

PMID Text
26708753 UNC80 encodes a large protein that is necessary for the stability and function of NALCN and for bridging NALCN to UNC79 to form a functional complex
26134120 Ohmic leak currents were identified in freshly isolated and cultured myometrial smooth muscle cells. NALCN contributes to this current. Uterine biopsies from term, non-laboring women revealed NALCN messenger RNA and protein expression in the myometrium.
25683120 We used exome and targeted next-generation sequencing to identify de novo mutations in NALCN as the cause of a newly delineated condition, CLIFAHDD syndrome.
24227479 This study found a plausible association, though not statistically confirmed, of cervical dystonia with SNPs in the NALCN region.
24075186 Two mutations, one missense and one nonsense, in NALCN in two unrelated families.
23749988 NALCN is the gene responsible for INAD with facial dysmorphism
20889312 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20674038 This study observed nominal association with rs9518320 and rs9518331, suggesting that NALCN is not related to schizophrenia risk.
20674038 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMTFEHYPPLQYV      1 - 70
TFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWVSLVLQVFEIADIVDQMSPWG     71 - 140
MLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWSVSIFLLFFLLLYGILGVQMFGTFTYHCVVN    141 - 210
DTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQE    211 - 280
GWVFLMYRAIDSFPRWRSYFYFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQM    281 - 350
FHEDAAGGWQLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL    351 - 420
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVLRVVRLIKISP    421 - 490
ALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTFPRAFMSMFQILTQEGWVDVM    491 - 560
DQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLR    561 - 630
LRIFEKFPNRPQMVKISKLPSDFTVPKIRESFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDN    631 - 700
KYIDQKLRKSVFSIRARNLLEKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHG    701 - 770
SNSQRISRGKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV    771 - 840
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCISMMFESPFR    841 - 910
RVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYLVSLIFLCWMPQNVPAES    911 - 980
GAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVSILLLTLMLVFASFGVQLFAGKLAKCNDPN    981 - 1050
IIRREDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEV   1051 - 1120
RDVIIHRVGPIHGIYIHVFVFLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHL   1121 - 1190
PPRPDNDGFRAKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI   1191 - 1260
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTLKMLLLTVVV   1261 - 1330
SMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITVLFRIVTGEDWNKIMHDCMV   1331 - 1400
QPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLLVAIIVENFSLFYSTEEDQLLSYNDLRHF   1401 - 1470
QIIWNMVDDKREGVIPTFRVKFLLRLLRGRLEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYR   1471 - 1540
SVDIRKSLQLEELLAREQLEYTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLN   1541 - 1610
PPSIETTQPSEDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPIS   1611 - 1680
HSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI               1681 - 1738
//

Text Mined References (28)

PMID Year Title
27214504 2016 Novel Mutations in the Nonselective Sodium Leak Channel (NALCN) Lead to Distal Arthrogryposis with Increased Muscle Tone.
26763878 2016 De novo missense mutations in NALCN cause developmental and intellectual impairment with hypotonia.
26708753 2016 Mutations in UNC80, Encoding Part of the UNC79-UNC80-NALCN Channel Complex, Cause Autosomal-Recessive Severe Infantile Encephalopathy.
26134120 2015 Sodium leak channel, non-selective contributes to the leak current in human myometrial smooth muscle cells from pregnant women.
25864427 2015 A Gain-of-Function Mutation in NALCN in a Child with Intellectual Disability, Ataxia, and Arthrogryposis.
25683120 2015 De novo mutations in NALCN cause a syndrome characterized by congenital contractures of the limbs and face, hypotonia, and developmental delay.
25416956 2014 A proteome-scale map of the human interactome network.
24227479 2014 Genomewide association study in cervical dystonia demonstrates possible association with sodium leak channel.
24132900 2013 Genome-wide association study of atypical psychosis.
24075186 2013 Mutations in NALCN cause an autosomal-recessive syndrome with severe hypotonia, speech impairment, and cognitive delay.
More...