Property Summary

NCBI Gene PubMed Count 38
PubMed Score 54.13
PubTator Score 22.14

Knowledge Summary

Patent (3,662)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Dementia 175 0.0 1.9
lung cancer 4740 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer -2.200 1.2e-20
adult high grade glioma -1.400 3.5e-06
atypical teratoid / rhabdoid tumor -2.000 4.3e-13
ependymoma -1.100 5.1e-08
glioblastoma -1.400 8.5e-10
group 3 medulloblastoma -2.000 1.2e-06
interstitial cystitis -2.000 2.1e-03
intraductal papillary-mucinous adenoma (... -1.400 2.3e-02
intraductal papillary-mucinous carcinoma... -2.200 1.6e-03
intraductal papillary-mucinous neoplasm ... -2.200 9.4e-03
lung carcinoma 2.800 4.1e-31
medulloblastoma, large-cell -2.000 2.0e-07
osteosarcoma -1.759 2.3e-02
ovarian cancer 2.400 4.3e-04
Pick disease -1.300 4.6e-03
primitive neuroectodermal tumor -1.600 1.3e-06
psoriasis -1.200 1.2e-33
subependymal giant cell astrocytoma -2.180 3.3e-02

Protein-protein Interaction (3)

Gene RIF (18)

AA Sequence

MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMTFEHYPPLQYV      1 - 70
TFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWVSLVLQVFEIADIVDQMSPWG     71 - 140
MLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWSVSIFLLFFLLLYGILGVQMFGTFTYHCVVN    141 - 210
DTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQE    211 - 280
GWVFLMYRAIDSFPRWRSYFYFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQM    281 - 350
FHEDAAGGWQLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYL    351 - 420
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVLRVVRLIKISP    421 - 490
ALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTFPRAFMSMFQILTQEGWVDVM    491 - 560
DQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLR    561 - 630
LRIFEKFPNRPQMVKISKLPSDFTVPKIRESFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDN    631 - 700
KYIDQKLRKSVFSIRARNLLEKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHG    701 - 770
SNSQRISRGKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV    771 - 840
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCISMMFESPFR    841 - 910
RVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYLVSLIFLCWMPQNVPAES    911 - 980
GAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVSILLLTLMLVFASFGVQLFAGKLAKCNDPN    981 - 1050
IIRREDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEV   1051 - 1120
RDVIIHRVGPIHGIYIHVFVFLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHL   1121 - 1190
PPRPDNDGFRAKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI   1191 - 1260
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTLKMLLLTVVV   1261 - 1330
SMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITVLFRIVTGEDWNKIMHDCMV   1331 - 1400
QPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLLVAIIVENFSLFYSTEEDQLLSYNDLRHF   1401 - 1470
QIIWNMVDDKREGVIPTFRVKFLLRLLRGRLEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYR   1471 - 1540
SVDIRKSLQLEELLAREQLEYTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLN   1541 - 1610
PPSIETTQPSEDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPIS   1611 - 1680
HSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI               1681 - 1738
//

Text Mined References (41)

PMID Year Title