Property Summary

NCBI Gene PubMed Count 23
PubMed Score 28.21
PubTator Score 221.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.72704743817159E-43
ependymoma 2514 2.26291105432218E-11
oligodendroglioma 2849 4.15902969025924E-11
pilocytic astrocytoma 3086 7.53316257138988E-8
pituitary cancer 1972 3.17741961944529E-7
primitive neuroectodermal tumor 3031 3.7395804207339E-7
adult high grade glioma 2148 1.39486601764458E-6
sonic hedgehog group medulloblastoma 1482 3.929780590403E-6
atypical teratoid / rhabdoid tumor 4369 6.66284273043163E-6
glioblastoma 5572 7.28435051106371E-6
medulloblastoma, large-cell 6234 7.16453330813298E-5
psoriasis 6685 5.80507599174919E-4
subependymal giant cell astrocytoma 2287 0.00120402403272957
astrocytic glioma 2241 0.00309128057141881
Pick disease 1893 0.0143528880994151
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.400 0.003
ependymoma -2.000 0.000
psoriasis -1.600 0.001
glioblastoma -3.400 0.000
oligodendroglioma -1.300 0.000
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.400 0.000
adult high grade glioma -2.900 0.000
pilocytic astrocytoma -1.900 0.000
subependymal giant cell astrocytoma -2.604 0.001
lung carcinoma 2.500 0.000
Pick disease -1.800 0.014
pituitary cancer 1.200 0.000

Synonym

Accession Q8IZD9 O15017
Symbols PBP
MOCA

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (2)

Gene RIF (11)

PMID Text
25687035 Results supported that miR-512-3p could inhibit tumor cell adhesion, migration, and invasion by regulating the RAC1 activity via DOCK3 in NSCLC A549 and H1299 cell lines.
22746061 It plays a role in axonal regeneration. (review)
22115042 MOCA is a key molecule of the Alzheimer disease-relevant neuronal death signals that links the presenilin-mediated death signal with the APP-mediated death signal at a point between Rac1 or Cdc42 and ASK1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368433 Dock3 induces axonal outgrowth by stimulating membrane recruitment of the WAVE complex
20307617 Observational study of gene-disease association. (HuGE Navigator)
20032819 Observational study of gene-disease association. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18716063 MOCA is a novel Wnt negative regulator and demonstrate that this screening approach can be a rapid means for isolation of new Wnt regulators.
More...

AA Sequence

MWTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKKPNVKGIFPANYIHLKKAIVS      1 - 70
NRGQYETVVPLEDSIVTEVTATLQEWASLWKQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVR     71 - 140
EVKRHITVRLDWGNEHLGLDLVPRKDFEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCR    141 - 210
MPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNGGPRNPEKIERMCALFTDLSS    211 - 280
KDMKRDLYIVAHVIRIGRMLLNDSKKGPPHLHYRRPYGCAVLSILDVLQSLTEVKEEKDFVLKVYTCNNE    281 - 350
SEWSQIHENIIRKSSAKYSAPSASHGLIISLQLLRGDMEQIRRENPMIFNRGLAITRKLGFPDVIMPGDI    351 - 420
RNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEI    421 - 490
IKLPIPIDRFRGSHLRFEFRHCSTKDKGEKKLFGFAFSTLMRDDGTTLSDDIHELYVYKCDENSTFNNHA    491 - 560
LYLGLPCCKEDYNGCPNIPSSLIFQRSTKESFFISTQLSSTKLTQNVDLLALLKWKAFPDRIMDVLGRLR    561 - 630
HVSGEEIVKFLQDILDTLFVILDDNTEKYGLLVFQSLVFIINLLRDIKYFHFRPVMDTYIQKHFAGALAY    631 - 700
KELIRCLKWYMDCSAELIRQDHIQEAMRALEYLFKFIVQSRILYSRATCGMEEEQFRSSIQELFQSIRFV    701 - 770
LSLDSRNSETLLFTQAALLNSFPTIFDELLQMFTVQEVAEFVRGTLGSMPSTVHIGQSMDVVKLQSIART    771 - 840
VDSRLFSFSESRRILLPVVLHHIHLHLRQQKELLICSGILGSIFSIVKTSSLEADVMEEVEMMVESLLDV    841 - 910
LLQTLLTIMSKSHAQEAVRGQRCPQCTAEITGEYVSCLLSLLRQMCDTHFQHLLDNFQSKDELKEFLLKI    911 - 980
FCVFRNLMKMSVFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQ    981 - 1050
LEIITSAKRKKILDKYGDMRVMMAYELFSMWQNLGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHD   1051 - 1120
MMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFSLLTQLFGPYPSLLEKVEQETWRETGISFV   1121 - 1190
TSVTRLMERLLDYRDCMKGEETENKKIGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFT   1191 - 1260
LLLYCELLQWEDRPLREFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSL   1261 - 1330
SWIRKMEASYYDNIMEQQRLEPEFFRVGFYGRKFPFFLRNKEYVCRGHDYERLEAFQQRMLSEFPQAVAM   1331 - 1400
QHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKENE   1401 - 1470
FKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRSLISQYQHKQVHGNINLL   1471 - 1540
SMCLNGVIDAAVNGGIARYQEAFFDKDYINKHPGDAEKITQLKELMQEQVHVLGVGLAVHEKFVHPEMRP   1541 - 1610
LHKKLIDQFQMMRASLYHEFPGLDKLSPACSGTSTPRGNVLASHSPMSPESIKMTHRHSPMNLMGTGRHS   1611 - 1680
SSSLSSHASSEAGNMVMLGDGSMGDAPEDLYHHMQLAYPNPRYQGSVTNVSVLSSSQASPSSSSLSSTHS   1681 - 1750
APSQMITSAPSSARGSPSLPDKYRHAREMMLLLPTYRDRPSSAMYPAAILENGQPPNFQRALFQQVVGAC   1751 - 1820
KPCSDPNLSVAEKGHYSLHFDAFHHPLGDTPPALPARTLRKSPLHPIPASPTSPQSGLDGSNSTLSGSAS   1821 - 1890
SGVSSLSESNFGHSSEAPPRTDTMDSMPSQAWNADEDLEPPYLPVHYSLSESAVLDSIKAQPCRSHSAPG   1891 - 1960
CVIPQDPMDPPALPPKPYHPRLPALEHDEGVLLREETERPRGLHRKAPLPPGSAKEEQARMAWEHGRGEQ   1961 - 2030
//

Text Mined References (23)

PMID Year Title
25687035 2015 Inhibition of RAC1-GEF DOCK3 by miR-512-3p contributes to suppression of metastasis in non-small cell lung cancer.
24980573 2014 Identification of a melanoma susceptibility locus and somatic mutation in TET2.
22746061 2012 [Role of Dock3 in axonal regeneration].
22115042 2012 MOCA is an integrator of the neuronal death signals that are activated by familial Alzheimer's disease-related mutants of amyloid ? precursor protein and presenilins.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20368433 2010 Dock3 induces axonal outgrowth by stimulating membrane recruitment of the WAVE complex.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
20032819 2010 Genetic variants in SLC9A9 are associated with measures of attention-deficit/hyperactivity disorder symptoms in families.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
More...