Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 4.9e-04
astrocytic glioma -2.000 2.4e-02
atypical teratoid / rhabdoid tumor -1.800 1.4e-03
glioblastoma -1.300 1.5e-04
group 3 medulloblastoma -1.900 1.3e-03
intraductal papillary-mucinous adenoma (... 1.300 1.8e-02
intraductal papillary-mucinous carcinoma... 1.100 3.6e-02
invasive ductal carcinoma 1.100 9.1e-03
medulloblastoma, large-cell -2.900 3.1e-07
oligodendroglioma -1.700 5.0e-02
Pick disease -1.100 7.8e-03
psoriasis -1.100 1.8e-07
X-linked cerebral adrenoleukodystrophy 2.100 1.3e-03

Gene RIF (2)

AA Sequence

MEVEEAFQAVGEMGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQSHGNQSAGEDQ      1 - 70
AFGDWLLTANGSEIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKK     71 - 140
VYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVG    141 - 210
IAQYALLGYFIRSWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFS    211 - 280
LTHPANRSCRETGSFLDLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPS    281 - 350
YPLCIYLINQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYI    351 - 420
YTSELYPTVIRNVGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLL    421 - 490
ETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK                 491 - 547
//

Text Mined References (10)

PMID Year Title