Property Summary

NCBI Gene PubMed Count 20
PubMed Score 1.45
PubTator Score 17.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 4.2e-06
ovarian cancer 8520 1.2e-04
group 3 medulloblastoma 4104 2.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
pancreatic cancer 2398 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.4e-04
ovarian cancer -1.100 1.2e-04
posterior fossa group B ependymoma 1.100 4.2e-06

Gene RIF (1)

AA Sequence

MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKH      1 - 70
GFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQ     71 - 140
GTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQ    141 - 210
RIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPR    211 - 280
RHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNAS    281 - 350
RTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQ    351 - 420
AHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPL    421 - 490
ESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSL    491 - 560
LLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTM                 561 - 617
//

Text Mined References (28)

PMID Year Title