Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.45
PubTator Score 17.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q8IZD4 B4DRD1 Q86XH9 Q96BP8 Q96MZ8
Symbols DCP1

Gene

Gene RIF (1)

PMID Text
21948796 HIV-1 Gag interacts with DCP1 in a miRNA- and P-body-independent manner

AA Sequence

MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKH      1 - 70
GFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQ     71 - 140
GTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQ    141 - 210
RIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPR    211 - 280
RHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNAS    281 - 350
RTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQ    351 - 420
AHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPL    421 - 490
ESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSL    491 - 560
LLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTM                 561 - 617
//

Text Mined References (26)

PMID Year Title
26826132 2016 Two-headed tetraphosphate cap analogs are inhibitors of the Dcp1/2 RNA decapping complex.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22142827 2012 A genome-wide association study of overall survival in pancreatic cancer patients treated with gemcitabine in CALGB 80303.
More...