Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.26
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.8e-04
glioblastoma -1.300 3.8e-03
medulloblastoma, large-cell -1.400 4.0e-03
posterior fossa group B ependymoma -1.300 1.3e-06
subependymal giant cell astrocytoma -1.290 3.0e-02

AA Sequence

MASSKLREPVDEVFDLDLAVPETARLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGK      1 - 70
VTDGCGSPLHRLRSPLHSGPGSPAGGSFCLDPPGLRRSLDEDEPPPSPLTRYRPLHNAASHEGLAAASCS     71 - 140
PPRSAPSSDSSPSFVRRHPRAEPHSEDDSRDASPPEPASPTIGLDKKTRRKFLDLGVTLRRASTGKSRKE    141 - 210
KGSNRLSMGSRESVEGSGRSGGSPFLPFSWFTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSD    211 - 280
DSTPPSSSPKIPSGPWQEAKCSYPYHTLSQSSDEFLDEPLPPVHHWTSQQVGQWLQSLNLEQYAAEFAAR    281 - 350
QVDGPQLLQLDGSKLKSLGLSNSHDRALVKRKLKEMAAAAEKERKAQEKAARQREKLRRREQEAKKS       351 - 417
//

Text Mined References (11)

PMID Year Title