Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.81
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

AA Sequence

MASSKLREPVDEVFDLDLAVPETARLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGK      1 - 70
VTDGCGSPLHRLRSPLHSGPGSPAGGSFCLDPPGLRRSLDEDEPPPSPLTRYRPLHNAASHEGLAAASCS     71 - 140
PPRSAPSSDSSPSFVRRHPRAEPHSEDDSRDASPPEPASPTIGLDKKTRRKFLDLGVTLRRASTGKSRKE    141 - 210
KGSNRLSMGSRESVEGSGRSGGSPFLPFSWFTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSD    211 - 280
DSTPPSSSPKIPSGPWQEAKCSYPYHTLSQSSDEFLDEPLPPVHHWTSQQVGQWLQSLNLEQYAAEFAAR    281 - 350
QVDGPQLLQLDGSKLKSLGLSNSHDRALVKRKLKEMAAAAEKERKAQEKAARQREKLRRREQEAKKS       351 - 417
//

Text Mined References (11)

PMID Year Title
22415137 2012 Boswellic acid induces epigenetic alterations by modulating DNA methylation in colorectal cancer cells.
21829388 2011 Trans-eQTLs reveal that independent genetic variants associated with a complex phenotype converge on intermediate genes, with a major role for the HLA.
18823374 2008 Frequent aberrant methylation of the promoter region of sterile alpha motif domain 14 in pulmonary adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
More...