Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus 1.800 4.9e-03
group 3 medulloblastoma 1.700 1.3e-04
interstitial cystitis 1.100 7.5e-03
intraductal papillary-mucinous neoplasm ... 1.400 8.9e-04
osteosarcoma -3.429 4.5e-09
primary Sjogren syndrome 1.500 4.2e-03
sarcoidosis 1.100 1.8e-02
tuberculosis and treatment for 6 months 1.100 5.7e-05

AA Sequence

MDSVAFEDVAVNFTQEEWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSLVERL      1 - 70
CGRKEGNEHRETFSQIPDCHLNKKSQTGVKPCKCSVCGKVFLRHSFLDRHMRAHAGHKRSECGGEWRETP     71 - 140
RKQKQHGKASISPSSGARRTVTPTRKRPYECKVCGKAFNSPNLFQIHQRTHTGKRSYKCREIVRAFTVSS    141 - 210
FFRKHGKMHTGEKRYECKYCGKPIDYPSLFQIHVRTHTGEKPYKCKQCGKAFISAGYLRTHEIRSHALEK    211 - 280
SHQCQECGKKLSCSSSLHRHERTHSGGKLYECQKCAKVFRCPTSLQAHERAHTGERPYECNKCGKTFNYP    281 - 350
SCFRRHKKTHSGEKPYECTRCGKAFGWCSSLRRHEMTHTGEKPFDCKQCGKVFTFSNYLRLHERTHLAGR    351 - 420
SQCFGRRQGDHLSPGV                                                          421 - 436
//

Text Mined References (14)

PMID Year Title