Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.79
PubTator Score 5.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.265 0.000
group 4 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.400 0.005
non-small cell lung carcinoma -3.300 0.000
lung adenocarcinoma -3.400 0.000
lung carcinoma -5.400 0.000
acute myeloid leukemia -1.100 0.014

Gene RIF (4)

PMID Text
24880483 miR-1246 promotes UVB-induced apoptosis by downregulating RTKN2 expression and that UVB-upregulated miR-1246 released RTKN2-dependent resistance to UVB-induced apoptosis by targeting RTKN2 post-transcriptionally in keratinocyte cells.
23028356 we identified two gene loci associated with rheumatoid arthritis susceptibility- NFKBIE and RTKN2
16385451 Observational study of gene-disease association. (HuGE Navigator)
15504364 Cloning and characterization of gene expression of rhotekin-2.

AA Sequence

MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTS      1 - 70
ELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANV     71 - 140
FDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKIS    141 - 210
SVLQEEDDEMCLLLSSAVFGVKYNLLAHTTLTLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQ    211 - 280
PACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKD    281 - 350
AKKRIHNFSVINPVPGQAITQIFAVDNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFL    351 - 420
TKEATSVYHDMSIDSPMKLESLTDIIQKKIEETNGQFLIGQHEESLPPPWATLFDGNHQMVIQKKVLYPA    421 - 490
SEPLHDEKGKKRQAPLPPSDKLPFSLKSQSNTDQLVKDNWGKTSVSQTSSLDTKLSTLMHHLQKPMAAPR    491 - 560
KLLPARRNRLSDGEHTDTKTNFEAKPVPAPRQKSIKDILDPRSWLQAQV                         561 - 609
//

Text Mined References (14)

PMID Year Title
24880483 2014 miR-1246 releases RTKN2-dependent resistance to UVB-induced apoptosis in HaCaT cells.
24751813 2014 Genome-wide association study supports the role of the immunological system and of the neurodevelopmental processes in response to haloperidol treatment.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23028356 2012 Functional variants in NFKBIE and RTKN2 involved in activation of the NF-?B pathway are associated with rheumatoid arthritis in Japanese.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15504364 2004 Identification and characterization of a lymphocytic Rho-GTPase effector: rhotekin-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...