Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.03
PubTator Score 5.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (9)

PMID Text
26814968 AAVR directly binds to AAV2 particles, and that anti-AAVR antibodies efficiently block AAV2 infection; moreover, genetic ablation of AAVR renders a wide range of mammalian cell types highly resistant to AAV2 infection
25596907 genetic association study in Han population in China: Data suggest an SNP in PXK [rs2176082(C/T); but not rs6445975(G/T)] is associated with recurrent pregnancy loss; SNPs in KIAA0319L [rs2275247(A/G)] or JAZF1 [rs1635852(C/T)] are not associated.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that KIAA0319L gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with KIAA0319L
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that KIAA0319L gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with KIAA0319L
23740937 Results identify KIAA0319L as novel susceptibility loci for Systemic sclerosis (SSc) and systemic lupus erythematosus (SLE). KIAA0319L was overexpressed in peripheral blood cells of SSc and SLE patients compared with healthy controls.
20697954 Kiaa0319-like protein interacts with Nogo Receptor 1, supporting the idea that Kiaa0319-like protein participates in axon guidance.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19085271 KIAA0319L remains an intriguing positional and functional candidate for RD, especially when considered alongside the supporting evidence for its homolog KIAA0319 on chromosome 6p.
19085271 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKRLGVKPNPASWILSGYYWQTSAKWLRSLYLFYTCFCFSVLWLSTDASESRCQQGKTQFGVGLRSGGE      1 - 70
NHLWLLEGTPSLQSCWAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFRTHSSNSMLVFLKKFQTADDL     71 - 140
GFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQSLIRKLQKRGSPSDVVTPIVTQHSKVNDSN    141 - 210
ELGGLTTSGSAEVHKAITISSPLTTDLTAELSGGPKNVSVQPEISEGLATTPSTQQVKSSEKTQIAVPQP    211 - 280
VAPSYSYATPTPQASFQSTSAPYPVIKELVVSAGESVQITLPKNEVQLNAYVLQEPPKGETYTYDWQLIT    281 - 350
HPRDYSGEMEGKHSQILKLSKLTPGLYEFKVIVEGQNAHGEGYVNVTVKPEPRKNRPPIAIVSPQFQEIS    351 - 420
LPTTSTVIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTT    421 - 490
ANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQGVRTPTLQ    491 - 560
LSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKII    561 - 630
SYLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEINKPPIAKITGN    631 - 700
VVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAK    701 - 770
GESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGVLDSDIIVQKIQPYTEQSTK    771 - 840
MVFFVQNEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFW    841 - 910
MENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGILSWTVICCCKRQKGKPKRKSKYKILDATDQESLE    911 - 980
LKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQTPLKARSPREEIL     981 - 1049
//

Text Mined References (21)

PMID Year Title
26814968 2016 An essential receptor for adeno-associated virus infection.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25596907 2015 Association between KIAA0319L, PXK and JAZF1 gene polymorphisms and unexplained recurrent pregnancy loss in Chinese Han couples.
25416956 2014 A proteome-scale map of the human interactome network.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20697954 2011 Dyslexia-associated kiaa0319-like protein interacts with axon guidance receptor nogo receptor 1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...