Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.36
PubTator Score 5.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25931111 CMTM1 and 3 are priority targets in glioblastomas. First insights into signalling of these two genes that might be conveyed by growth factor receptor, Src family kinase and WNT activation was presented.
25175386 Study shows that CMTM1_v17 is highly expressed in human testis and many human tumor tissues and cell lines and seems to enhance cell proliferation and resistance to tumor necrosis factor-alpha (TNF-alpha)-induced apoptosis in MDA-MB-231 breast cancer cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15778092 novel evidence that the final intron/exon region of the CKLFSF1 gene contains a novel eukaryotic promoter capable of directing expression of the downstream gene, CKLFSF2
15147728 gene structure, mapping to chromsome 16, identification of altenative transcription start sites, expression in spermatocyte and testes
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHH      1 - 70
LLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAVIVCCIDAFVVTTKMRTNLKR     71 - 140
FLGVEVERKLSPAKDAYPETGPDAPQRPA                                             141 - 169
//

Text Mined References (9)

PMID Year Title
25931111 2015 Systematic investigation of CMTM family genes suggests relevance to glioblastoma pathogenesis and CMTM1 and CMTM3 as priority targets.
25175386 2014 CMTM1_v17 is a novel potential therapeutic target in breast cancer.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15778092 2005 A functional promoter region of the CKLFSF2 gene is located in the last intron/exon region of the upstream CKLFSF1 gene.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147728 2004 Molecular cloning and characterization of chemokine-like factor super family member 1 (CKLFSF1), a novel human gene with at least 23 alternative splicing isoforms in testis tissue.
12782130 2003 Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.