Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.36
PubTator Score 5.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Centronuclear myopathy 27 3.259 1.6

Expression

Gene RIF (7)

AA Sequence

MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHH      1 - 70
LLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAVIVCCIDAFVVTTKMRTNLKR     71 - 140
FLGVEVERKLSPAKDAYPETGPDAPQRPA                                             141 - 169
//

Text Mined References (10)

PMID Year Title