Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.89
PubTator Score 2.33

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Gout 104 4.32 2.2
Gout, HPRT-Related 2 0.0 0.0
Hyperuricemia 47 0.0 0.0
Disease Target Count P-value
Atopic dermatitis 952 1.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8


  Differential Expression (1)

Disease log2 FC p
Atopic dermatitis 1.300 1.7e-05


Accession Q8IZ83 B4DLQ1 C9JBH6 Q86YF0 Q8IYL4 Q8TEI8


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

CPRAWDQEAEGAGPELGLRVARTKALWLPMGD                                          771 - 802

Text Mined References (16)

PMID Year Title