Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.30
PubTator Score 5.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.200 8.5e-04
atypical teratoid / rhabdoid tumor 1.800 1.1e-06
Breast cancer 1.400 2.2e-10
diabetes mellitus -1.200 2.1e-03
ductal carcinoma in situ 1.200 1.4e-04
ependymoma 1.500 3.6e-09
glioblastoma 1.200 4.7e-06
group 3 medulloblastoma 1.300 2.7e-03
invasive ductal carcinoma 1.900 9.8e-04
medulloblastoma, large-cell 2.100 3.3e-06
osteosarcoma 1.080 2.5e-02
ovarian cancer 1.100 7.5e-03

Synonym

Accession Q8IZ81 B2R712 D3DNZ0
Symbols 9830169G11Rik

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Gene RIF (4)

AA Sequence

MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV      1 - 70
DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP     71 - 140
TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN    141 - 210
LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG    211 - 280
LLLDCNVALTLKV                                                             281 - 293
//

Text Mined References (11)

PMID Year Title