Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 6
Funding $471,802
PubMed Score 3.05
PubTator Score 5.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.080 0.025
posterior fossa group B ependymoma 1.800 0.000
glioblastoma 1.600 0.000
group 4 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
medulloblastoma, large-cell 2.100 0.000
diabetes mellitus -1.200 0.002
pediatric high grade glioma 1.300 0.000
Breast cancer 1.400 0.000
ductal carcinoma in situ 1.200 0.000
invasive ductal carcinoma 1.900 0.001
ovarian cancer 1.100 0.007

Gene RIF (4)

PMID Text
24616099 The non-opioid sigma-1 receptor (S1R) was identified as a novel effector of GAP activity of ELMOD1-3 proteins as its direct binding to either ELMOD1 or ELMOD2 resulted in loss of GAP activity.
19966137 TLR3 pathway is dependent on ELMOD2
17452337 Results describe the purification from bovine testis of an Arl2 GAP and its identity as ELMOD2, a protein with no previously described function.
16773575 results suggest ELMOD2 as a novel candidate gene for susceptibility in familial idiopathic pulmonary fibrosis

AA Sequence

MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV      1 - 70
DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP     71 - 140
TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN    141 - 210
LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG    211 - 280
LLLDCNVALTLKV                                                             281 - 293
//

Text Mined References (11)

PMID Year Title
24616099 2014 Characterization of recombinant ELMOD (cell engulfment and motility domain) proteins as GTPase-activating proteins (GAPs) for ARF family GTPases.
21269460 2011 Initial characterization of the human central proteome.
19966137 2010 ELMOD2, a candidate gene for idiopathic pulmonary fibrosis, regulates antiviral responses.
19946888 2010 Defining the membrane proteome of NK cells.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
16773575 2006 ELMOD2 is a candidate gene for familial idiopathic pulmonary fibrosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...