Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.45
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
malignant mesothelioma 3232 1.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 1.5e-05

 GO Process (1)

 Compartment GO Term (2)

Gene RIF (3)

AA Sequence

MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTS      1 - 70
EIFKLELQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLS     71 - 140
VRLARPKADPMARRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALL    141 - 210
PWLLEQRHKHNKACCPLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVH    211 - 280
IPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLA    281 - 350
QHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVL    351 - 420
YTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAE    421 - 490
DLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKG    491 - 560
IPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS         561 - 625
//

Text Mined References (16)

PMID Year Title