Property Summary

NCBI Gene PubMed Count 12
Grant Count 341
R01 Count 99
Funding $55,971,287.63
PubMed Score 52.76
PubTator Score 75.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.800 0.000
posterior fossa group A ependymoma -4.400 0.000
glioblastoma -2.900 0.000
oligodendroglioma -1.300 0.000
medulloblastoma -2.300 0.001
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -2.100 0.009
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.900 0.000
lung carcinoma 2.800 0.000
Pick disease -1.300 0.041

Synonym

Accession Q8IZ57 B2RAV4 Q8N8R6 Q96P21
Symbols VMP
p24

Gene

Gene RIF (3)

PMID Text
20807314 dilysine retrieval signal-containing p24 proteins, p24alpha(2) and p24delta(1), bind with gamma-secretase complexes and collaborate in attenuating gamma-cleavage of beta-amyloid precursor protein
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12463420 Cloning, expression and characterization of VMP gene.

AA Sequence

MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGT      1 - 70
VFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFV     71 - 140
KSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT                   141 - 195
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20807314 2010 Dilysine retrieval signal-containing p24 proteins collaborate in inhibiting ?-cleavage of amyloid precursor protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463420 2002 Cloning, expression and characterization of a novel human VMP gene.
More...