Property Summary

NCBI Gene PubMed Count 12
PubMed Score 52.76
PubTator Score 75.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.39515563752719E-18
lung carcinoma 2844 3.46862150110281E-16
astrocytoma 1493 8.83518292713443E-15
atypical teratoid / rhabdoid tumor 4369 2.94073723585121E-11
pilocytic astrocytoma 3086 1.02649112383263E-7
oligodendroglioma 2849 2.4807767255609E-6
glioblastoma 5572 3.89643501445785E-6
pediatric high grade glioma 2712 4.88558359237977E-6
medulloblastoma, large-cell 6234 4.74912937438737E-5
medulloblastoma 1524 8.72002045162199E-4
primitive neuroectodermal tumor 3031 0.00903597404744909
Pick disease 1893 0.041160668402384
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Relapsing fever 16 7.456 3.7
Lyme disease 23 4.278 2.1
Tick infestation 16 3.731 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.800 0.000
posterior fossa group A ependymoma -4.400 0.000
glioblastoma -2.900 0.000
oligodendroglioma -1.300 0.000
medulloblastoma -2.300 0.001
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -2.100 0.009
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.900 0.000
lung carcinoma 2.800 0.000
Pick disease -1.300 0.041

Synonym

Accession Q8IZ57 B2RAV4 Q8N8R6 Q96P21
Symbols VMP
p24

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
20807314 dilysine retrieval signal-containing p24 proteins, p24alpha(2) and p24delta(1), bind with gamma-secretase complexes and collaborate in attenuating gamma-cleavage of beta-amyloid precursor protein
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12463420 Cloning, expression and characterization of VMP gene.

AA Sequence

MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGT      1 - 70
VFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFV     71 - 140
KSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT                   141 - 195
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20807314 2010 Dilysine retrieval signal-containing p24 proteins collaborate in inhibiting ?-cleavage of amyloid precursor protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463420 2002 Cloning, expression and characterization of a novel human VMP gene.
More...