Property Summary

NCBI Gene PubMed Count 12
PubMed Score 53.92
PubTator Score 75.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.300 2.5e-03
astrocytic glioma -1.700 6.1e-03
Astrocytoma, Pilocytic -2.900 6.5e-08
atypical teratoid / rhabdoid tumor -4.200 2.9e-11
ependymoma -2.200 3.2e-02
glioblastoma -2.600 1.0e-07
group 3 medulloblastoma -2.100 4.8e-03
lung carcinoma 2.800 3.5e-16
medulloblastoma, large-cell -2.600 4.7e-05
oligodendroglioma -1.300 2.5e-06
Pick disease -1.300 4.1e-02
primitive neuroectodermal tumor -2.100 9.0e-03

Synonym

Accession Q8IZ57 B2RAV4 Q8N8R6 Q96P21
Symbols VMP
p24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGT      1 - 70
VFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFV     71 - 140
KSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT                   141 - 195
//

Text Mined References (12)

PMID Year Title