Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $146,051.5
PubMed Score 15.66
PubTator Score 11.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.604 0.001
glioblastoma 1.200 0.000
active ulcerative colitis 1.162 0.005

Synonym

Accession Q8IZ52 B4DXU0 Q6UXD6 Q7L4G1 Q9H0F8 Q9H618
Symbols CSS2
CHSY2

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (5)

PMID Text
22461910 CHPF was found to be differentially methylated in human squamous cell carcinomas.
22082830 study reports a novel protein named Klokin 1(a splice variant of chondroitin polymerizing factor) that transports Parkin to the mitochondria; findings indicate that mitochondrial Parkin prevents mitochondrial depolarization and that Klokin 1 may compensate for Parkin deficiency
21468578 The present study focused on the expression of chondroitin-synthesizing enzymes in colorectal cancer.
20729547 Chondroitin sulfate synthase-2/chondroitin polymerizing factor has two variants with distinct function
12716890 chondroitin polymerizing activity requires concomitant expression of a ChPF with ChSy; coexpression of the ChPF and ChSy yielded markedly augmented glycosyltransferase activities, whereas simple mixing of the two separately expressed proteins did not.

AA Sequence

MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAE      1 - 70
REKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLLVAVLTSQTTLPTLGVAVNRT     71 - 140
LGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLALRHLLEQHGDDFDWFFLVPDTTYTEAHGLA    141 - 210
RLTGHLSLASAAHLYLGRPQDFIGGEPTPGRYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLG    211 - 280
RCILDATGVGCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQ    281 - 350
EIQELQWEIQNTSHLAVDGDQAAAWPVGIPAPSRPASRFEVLRWDYFTEQHAFSCADGSPRCPLRGADRA    351 - 420
DVADVLGTALEELNRRYHPALRLQKQQLVNGYRRFDPARGMEYTLDLQLEALTPQGGRRPLTRRVQLLRP    421 - 490
LSRVEILPVPYVTEASRLTVLLPLAAAERDLAPGFLEAFATAALEPGDAAAALTLLLLYEPRQAQRVAHA    491 - 560
DVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDLLSKKHPLDTLFLLAGPDTVLTPDFLNRCRM    561 - 630
HAISGWQAFFPMHFQAFHPAVAPPQGPGPPELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEE    631 - 700
LLESLDVYELFLHFSSLHVLRAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQLAMLLFEQE    701 - 770
QGNST                                                                     771 - 775
//

Text Mined References (14)

PMID Year Title
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
22082830 2012 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential.
21468578 Chondroitin synthases I, II, III and chondroitin sulfate glucuronyltransferase expression in colorectal cancer.
20729547 2010 Chondroitin sulfate synthase-2/chondroitin polymerizing factor has two variants with distinct function.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...