Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.98
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 2.100 1.1e-05
medulloblastoma, large-cell 2.900 6.3e-08
osteosarcoma 1.418 3.3e-04
ovarian cancer -1.100 1.2e-06
primitive neuroectodermal tumor 1.200 4.5e-03
psoriasis -1.200 7.9e-21

Gene RIF (2)

AA Sequence

MPSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNK      1 - 70
ELKGMLVWSPNHCVSDAKLDKYIAMAKEKHGYNIEQALGMLLWHKHDVEKSLADLANFTPFPDEWTVEDK     71 - 140
VLFEQAFGFHGKCFQRIQQMLPDKLIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRG    141 - 210
GVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLA    211 - 280
NLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKD    281 - 350
FGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEV    351 - 420
QITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLI    421 - 490
RPALAAPRHSARPGPQPPPTLIGTPLEPPAPSL                                         491 - 523
//

Text Mined References (9)

PMID Year Title