Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.65
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.87055278441038E-21
medulloblastoma, large-cell 6234 6.32132843884095E-8
sonic hedgehog group medulloblastoma 1482 3.21591231826329E-7
ovarian cancer 8492 1.21535448337997E-6
osteosarcoma 7933 3.26266407338093E-4
primitive neuroectodermal tumor 3031 0.00447727605552645

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.418 0.000
sonic hedgehog group medulloblastoma 2.400 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 1.200 0.004
ovarian cancer -1.100 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8IZ40 Q96FP3
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
21876670 LSD1/KDM1 and CoREST proteins are recruited to the HIV-1 LTR in response to HIV-1 Tat and formation of the LSD1/KDM1/CoREST complex functions as a co-activator of HIV-1 transcription
21433225 Ectopic expression of Rcor2 in both mouse and human somatic cells effectively substituted the requirement for exogenous Sox2 expression in somatic cell reprogramming.

AA Sequence

MPSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNK      1 - 70
ELKGMLVWSPNHCVSDAKLDKYIAMAKEKHGYNIEQALGMLLWHKHDVEKSLADLANFTPFPDEWTVEDK     71 - 140
VLFEQAFGFHGKCFQRIQQMLPDKLIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRG    141 - 210
GVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLA    211 - 280
NLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKD    281 - 350
FGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEV    351 - 420
QITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLI    421 - 490
RPALAAPRHSARPGPQPPPTLIGTPLEPPAPSL                                         491 - 523
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21433225 2011 RCOR2 is a subunit of the LSD1 complex that regulates ESC property and substitutes for SOX2 in reprogramming somatic cells to pluripotency.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.