Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.19
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.300 0.000
osteosarcoma 1.476 0.000
group 3 medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
primitive neuroectodermal tumor 1.100 0.000
juvenile dermatomyositis 1.302 0.000
cystic fibrosis -1.100 0.001
spina bifida -1.922 0.027
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
23319639 Data indicate that Phactr4 acts as a tumor suppressor that is deleted and mutant in several cancers.
15107502 The authors show that rat Phactr1 inhibits PP1 activity in vitro, and mouse Phactr4 coimmunoprecipitates with actin and PP1 in human cells.

AA Sequence

MEDPFEEADQPTTEPGMVLDSVEAGDTTPPTKRKSKFSGFGKIFKPWKWRKKKSSDKFKETSEVLERKIS      1 - 70
MRKPREELVKRGVLLEDPEQGGEDPGKPSDAMLKNGHTTPIGNARSSSPVQVEEEPVRLASLRKAIPEED     71 - 140
LKKRLGSTGSQPNSEAESVPENVPKPPLLPPKRPLSSSHEASEGQAKDATSSGGTARFIISTSITTAPAA    141 - 210
TTAATSLAKTVNLSVTPSPAPRTLPAAPASTNTTATPSLTHMVPAKQPPIPPPKPAHRNSNPVIAELSQA    211 - 280
INSGTLLSKPSPPLPPKRGIPSTSVPTLESAAAITTKTPSDEREKSTCSMGSELLPMISPRSPSPPLPTH    281 - 350
IPPEPPRTPPFPAKTFQVVPEIEFPPSLDLHQEIPQQEDQKKEVPKRILDQNFGEPHIPSRLPPLPLHIR    351 - 420
IQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFS    421 - 490
EEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPE    491 - 560
LNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQR    561 - 630
PTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHEESKHFTRYH    631 - 700
RP                                                                        701 - 702
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319639 2013 STOP gene Phactr4 is a tumor suppressor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...