Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.3e-08
medulloblastoma, large-cell 6241 1.5e-05
group 4 medulloblastoma 1855 1.1e-04

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.500 1.1e-04
medulloblastoma, large-cell -1.200 1.5e-05
osteosarcoma -1.257 4.3e-08

AA Sequence

MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKL      1 - 70
GESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQ     71 - 140
VRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL        141 - 206
//

Text Mined References (5)

PMID Year Title