Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.28173161488157E-8
medulloblastoma, large-cell 6234 1.53768003571949E-5
group 4 medulloblastoma 1875 1.10993520775804E-4

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.257 0.000
medulloblastoma, large-cell -1.200 0.000
group 4 medulloblastoma -1.500 0.000

Synonym

Accession Q8IZ16
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid

AA Sequence

MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKL      1 - 70
GESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQ     71 - 140
VRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL        141 - 206
//

Text Mined References (5)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.