Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis 1.033 0.000
malignant mesothelioma 1.600 0.000
psoriasis -1.100 0.000
medulloblastoma 1.100 0.001
adrenocortical carcinoma 1.933 0.000
lung cancer 1.500 0.000
sarcoidosis 1.200 0.014
lung carcinoma 1.900 0.000
ovarian cancer -1.700 0.000

AA Sequence

MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMP      1 - 70
APSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVP     71 - 140
LSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYIKEREIVEEFLFCEPL    141 - 210
QLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVI    211 - 280
KTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEI    281 - 350
NQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIE    351 - 420
KRNFTNFPFLEEIIVSDNEGIFIAAEITLHLQQLSNFFHGYFSIGDLNEASKWILDPFLFNIDFVDDSYL    421 - 490
MKNDLAELRASGQILMEFETMKLEDFWCAQFTAFPNLAKTALEILMPFATTYLCELGFSSLLHFKTKSRS    491 - 560
CFNLSDDIRVAISKKVPRFSDIIEQKLQLQQKSL                                        561 - 594
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
23166581 2012 Comparative analysis of the recently discovered hAT transposon TcBuster in human cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10607616 1999 Interspersed repeats and other mementos of transposable elements in mammalian genomes.