Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 9.2e-13
malignant mesothelioma 3232 4.2e-07
ovarian cancer 8520 4.3e-07
adrenocortical carcinoma 1428 6.4e-06
lung cancer 4740 6.4e-05
nephrosclerosis 333 3.5e-04
psoriasis 6694 4.2e-04
sarcoidosis 370 1.4e-02
group 4 medulloblastoma 1855 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.933 6.4e-06
group 4 medulloblastoma 1.100 2.6e-02
lung cancer 1.500 6.4e-05
lung carcinoma 1.900 9.2e-13
malignant mesothelioma 1.600 4.2e-07
nephrosclerosis 1.033 3.5e-04
ovarian cancer -1.700 4.3e-07
psoriasis -1.100 4.2e-04
sarcoidosis 1.200 1.4e-02

Synonym

Accession Q8IZ13 D3DQJ9 Q9H5S8 Q9UH87
Symbols Buster3
C5orf54

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMP      1 - 70
APSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVP     71 - 140
LSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYIKEREIVEEFLFCEPL    141 - 210
QLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVI    211 - 280
KTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEI    281 - 350
NQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIE    351 - 420
KRNFTNFPFLEEIIVSDNEGIFIAAEITLHLQQLSNFFHGYFSIGDLNEASKWILDPFLFNIDFVDDSYL    421 - 490
MKNDLAELRASGQILMEFETMKLEDFWCAQFTAFPNLAKTALEILMPFATTYLCELGFSSLLHFKTKSRS    491 - 560
CFNLSDDIRVAISKKVPRFSDIIEQKLQLQQKSL                                        561 - 594
//

Text Mined References (10)

PMID Year Title