Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.73

Knowledge Summary

Patent (3,965)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.9755361311439E-9
osteosarcoma 7933 1.36197349389432E-6
atypical teratoid / rhabdoid tumor 4369 2.33072578080888E-6
malignant mesothelioma 3163 1.01561956063186E-4

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 1.444 0.000
posterior fossa group B ependymoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000

Synonym

Accession Q8IZ08 Q7Z604 Q86SM3 Q8NH39
Symbols HUMNPIIY20

Gene

PANTHER Protein Class (2)

  Ortholog (5)

  TechDev Info (1)

Gene RIF (2)

PMID Text
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of G protein-coupled receptor 135 (GPR135) in U-937 macrophages
20198315 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASGGGTAAAPGGG      1 - 70
GLGGSGAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNA     71 - 140
FILSLSLSDLLTALLCLPAAFLDLFTPPGGSAPAAAAGPWRGFCAASRFFSSCFGIVSTLSVALISLDRY    141 - 210
CAIVRPPREKIGRRRALQLLAGAWLTALGFSLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVG    211 - 280
LVVACYLLPFLLMCFCHYHICKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFL    281 - 350
VLLAAARQAQTMQAPSLLSVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGP    351 - 420
GLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAG    421 - 490
DTSL                                                                      491 - 494
//

Text Mined References (6)

PMID Year Title
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.