Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.35
PubTator Score 0.73

Knowledge Summary

Patent (3,965)

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.0e-08
osteosarcoma 7950 1.4e-06
atypical teratoid / rhabdoid tumor 5112 2.3e-06
malignant mesothelioma 3232 1.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.3e-06
ependymoma 1.200 3.0e-08
malignant mesothelioma 1.100 1.0e-04
osteosarcoma 1.444 1.4e-06

Gene RIF (3)

AA Sequence

MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASGGGTAAAPGGG      1 - 70
GLGGSGAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNA     71 - 140
FILSLSLSDLLTALLCLPAAFLDLFTPPGGSAPAAAAGPWRGFCAASRFFSSCFGIVSTLSVALISLDRY    141 - 210
CAIVRPPREKIGRRRALQLLAGAWLTALGFSLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVG    211 - 280
LVVACYLLPFLLMCFCHYHICKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFL    281 - 350
VLLAAARQAQTMQAPSLLSVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGP    351 - 420
GLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAG    421 - 490
DTSL                                                                      491 - 494
//

Text Mined References (7)

PMID Year Title