Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
diabetes mellitus -1.300 1.5e-03
group 3 medulloblastoma 1.300 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.3e-03
juvenile dermatomyositis 1.319 7.1e-13
lung carcinoma -1.300 1.7e-33
non diabetic and post-ischemic heart fai... -1.400 2.9e-02
osteosarcoma -2.137 7.3e-07
ovarian cancer -1.100 7.0e-04
pancreatic cancer 1.100 7.1e-03
progressive supranuclear palsy -1.300 1.2e-02
spina bifida -1.399 3.6e-02

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVLLRHKADVTKE      1 - 70
NRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAPDFYVQMKWEFTSWVPLVSRI     71 - 140
CPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKGEDNWAELMEVNHDDKVVTTERFDLSQEMER    141 - 210
LTLDLMKPKSREVERRLTSPVINTSLDTKNIAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKI    211 - 280
RTEHLTEEEKKRYKADRNPLESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRP    281 - 350
KELTIRTQKFKAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN    351 - 420
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQF    421 - 490
AIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMEL    491 - 560
SAKELEEWELRLQEEEAELQQVLQLSLTDK                                            561 - 590
//

Text Mined References (12)

PMID Year Title