Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.41
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Lung Diseases, Interstitial 15
Disease Target Count P-value
posterior fossa group B ependymoma 1530 9.27584641654696E-16
nasopharyngeal carcinoma 1056 2.27029874888418E-8
osteosarcoma 7933 1.31482006507251E-7
pituitary cancer 1972 8.38382468212618E-6
ductal carcinoma in situ 1745 0.00249512741023802
invasive ductal carcinoma 2950 0.00649290938897099
fibroadenoma 557 0.0427924946151301
Disease Target Count Z-score Confidence
interstitial lung disease 292 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.174 0.000
posterior fossa group B ependymoma 4.000 0.000
fibroadenoma -1.100 0.043
nasopharyngeal carcinoma -3.000 0.000
ductal carcinoma in situ -1.200 0.002
invasive ductal carcinoma -1.400 0.006
pituitary cancer 1.300 0.000

Synonym

Accession Q8IZ02 B4DEJ7 E9PBH2 G5E9T7
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24991885 LRRC34 is a novel nucleolar protein that is predominantly expressed in pluripotent stem cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNLCMEKSQKINPFILHILQEVDEEI      1 - 70
KKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNL     71 - 140
IYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLEEST    141 - 210
VHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLE    211 - 280
VIDLSFNRIENAGANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEAT    281 - 350
CIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP     351 - 419
//

Text Mined References (10)

PMID Year Title
24991885 2014 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23900074 2013 A genome-wide association scan (GWAS) for mean telomere length within the COGS project: identified loci show little association with hormone-related cancer risk.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.