Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.41
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.174 0.000
posterior fossa group B ependymoma 4.000 0.000
fibroadenoma -1.100 0.043
nasopharyngeal carcinoma -3.000 0.000
ductal carcinoma in situ -1.200 0.002
invasive ductal carcinoma -1.400 0.006
pituitary cancer 1.300 0.000

Gene RIF (2)

PMID Text
24991885 LRRC34 is a novel nucleolar protein that is predominantly expressed in pluripotent stem cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNLCMEKSQKINPFILHILQEVDEEI      1 - 70
KKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNL     71 - 140
IYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLEEST    141 - 210
VHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLE    211 - 280
VIDLSFNRIENAGANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEAT    281 - 350
CIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP     351 - 419
//

Text Mined References (10)

PMID Year Title
24991885 2014 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23900074 2013 A genome-wide association scan (GWAS) for mean telomere length within the COGS project: identified loci show little association with hormone-related cancer risk.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.