Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.61
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 2.8e-11
nasopharyngeal carcinoma 1058 2.2e-06
pituitary cancer 1972 8.4e-06
osteosarcoma 7950 9.9e-06
ductal carcinoma in situ 1745 2.5e-03
invasive ductal carcinoma 2951 1.5e-02
fibroadenoma 559 4.3e-02
Disease Target Count Z-score Confidence
interstitial lung disease 298 0.0 3.0
Disease Target Count Z-score Confidence
Ciliopathy 71 3.147 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ -1.200 2.5e-03
ependymoma 2.900 2.8e-11
fibroadenoma -1.100 4.3e-02
invasive ductal carcinoma -1.100 1.5e-02
nasopharyngeal carcinoma -1.900 2.2e-06
osteosarcoma -1.674 9.9e-06
pituitary cancer 1.300 8.4e-06

Gene RIF (2)

AA Sequence

MGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNLCMEKSQKINPFILHILQEVDEEI      1 - 70
KKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNL     71 - 140
IYLNLMFNDIGPEGGELIAKVLHKNRTLKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLEEST    141 - 210
VHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLE    211 - 280
VIDLSFNRIENAGANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEAT    281 - 350
CIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP     351 - 419
//

Text Mined References (10)

PMID Year Title