Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.20
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.046 2.0e-02
intraductal papillary-mucinous adenoma (... 1.300 8.5e-03
osteosarcoma -1.308 3.7e-04
posterior fossa group B ependymoma 1.500 4.6e-09
psoriasis -1.300 7.6e-51

Gene RIF (1)

AA Sequence

MQSPAATAEGLSGPLFGAYTFPTFKFQPRHDSMDWRRISTLDVDRVARELDVATLQENIAGITFCNLDRE      1 - 70
VCSRCGQPVDPALLKVLRLAQLIIEYLLHCQDCLSASVAQLEARLQTSLGQQQRGQQELGRQADELKGVR     71 - 140
EESRRRRKMISTLQQLLMQTGTHSYHTCHLCDKTFMNATFLRGHIQRRHAGVAEGGKQKKQEQPVEEVLE    141 - 210
ELRAKLKWTQGELEAQREAERQRQLQEAELIHQREIEAKKEFDKWKEQEWTKLYGEIDKLKKLFWDEFKN    211 - 280
VAKQNSTLEEKLRALQSHSVMESKLGSLRDEESEEWLRQARELQALREKTEIQKTEWKRKVKELHEEHMA    281 - 350
EKKELQEENQRLQASLSQDQKKAAAQSQCQISTLRAQLQEQARIIASQEEMIQSLSLRKVEGIHKVPKAV    351 - 420
DTEEDSPEEEMEDSQDEQHKVLAALRRNPTLLKHFRPILEDTLEEKLESMGIRKDAKGISIQTLRHLESL    421 - 490
LRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQSTLVTREAQPKTRTLQV    491 - 560
ALPSTPAEPPPPTRQSHGSHGSSLTQVSAPAPRPGLHGPSSTPPSSGPGMSTPPFSSEEDSEGDRVQRVS    561 - 630
LQPPKVPSRMVPRPKDDWDWSDTETSEENAQPPGQGSGTLVQSMVKNLEKQLEAPAKKPAGGVSLFFMPN    631 - 700
AGPQRAATPGRKPQLSEDESDLEISSLEDLPLDLDQREKPKPLSRSKLPEKFGTGPQSSGQPRVPAW       701 - 767
//

Text Mined References (8)

PMID Year Title