Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.10
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.3e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.833 6.3e-04

AA Sequence

MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQEKIHRLE      1 - 70
LERTQAEDNLNILSREAAQYKKALENETNERNLAHQELIKQKKDISIQLSSAQSRCTLLEKQLEYTKRMV     71 - 140
LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQKTAEDKIKHLEEKLKEEEHQR    141 - 210
KLFQDKASELQTGLEISKIIMSSVSNLKHSKEKKKSSKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRD    211 - 280
PHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQELLKQMKE    281 - 350
TESHSVCDDIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQEDSYPKGSKNIK    351 - 420
NSPRKCLTDTNLFQKNSSFHPIRVHNLQMKLRRDDIMWEQ                                  421 - 460
//

Text Mined References (13)

PMID Year Title