Property Summary

NCBI Gene PubMed Count 15
Grant Count 16
R01 Count 11
Funding $2,049,451.41
PubMed Score 24.58
PubTator Score 13.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Testicular cancer 24 3.639 1.8
Teratoma 4 3.239 1.6

Gene RIF (11)

PMID Text
26740055 RBM38 and DND1 are repressed in primary acute myeloid leukemia, neutrophil differentiation is dependent on increased expression of both proteins, and they have a role in regulating p21(CIP1) expression during acute promyelocytic leukemia differentiation
23890083 APOBEC3G inhibits DND1 function to regulate microRNA activity.
22614019 The increased sensitivity of transformed keratinocytes to miR-21's effects occurs in part through downregulation of the RNA-binding protein DND1 during the transformation process.
21851623 Results suggest that DND1 may impose another level of translational regulation to modulate expression of critical factors in ES cells.
20816961 MiR-24 up-regulation reduced the expression of RNA-binding protein dead end 1 (DND1). Knockdown of miR-24 led to enhanced expression of DND1.
20411342 We conclude that germline DND1 mutations are unlikely to contribute significantly to human testicular germ cell tumor susceptibility
20411342 Observational study of gene-disease association. (HuGE Navigator)
18155131 Unravels a novel role of Dnd1 in protecting certain mRNAs from miRNA-mediated repression.
18069663 The variant, p. Glu86Ala, found in only one case of testiciular germ cell tumor, is within a known functional domain of DND1 and is highly conserved through evolution; mutations in DND1 make, at most, a very small contribution to TGCT susceptibility
18069663 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGSEVFIGRLPQDVY      1 - 70
EHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCEL     71 - 140
SVDGLPPNLTRSALLLALQPLGPGLQEARLLPSPGPAPGQIALLKFSSHRAAAMAKKALVEGQSHLCGEQ    141 - 210
VAVEWLKPDLKQRLRQQLVGPFLRSPQPEGSQLALARDKLGFQGARATLQLLCQRMKLGSPVFLTKCLGI    211 - 280
GPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSAGAEAGTM    281 - 350
VKQ                                                                       351 - 353
//

Text Mined References (15)

PMID Year Title
26740055 2016 The RNA binding proteins RBM38 and DND1 are repressed in AML and have a novel function in APL differentiation.
23890083 2013 APOBEC3 inhibits DEAD-END function to regulate microRNA activity.
22614019 2013 The Grainyhead transcription factor Grhl3/Get1 suppresses miR-21 expression and tumorigenesis in skin: modulation of the miR-21 target MSH2 by RNA-binding protein DND1.
21851623 2011 Transcripts that associate with the RNA binding protein, DEAD-END (DND1), in embryonic stem (ES) cells.
20816961 2010 MicroRNA-24 targeting RNA-binding protein DND1 in tongue squamous cell carcinoma.
20411342 2010 Screening for germline DND1 mutations in testicular cancer patients.
18414021 2008 Interplay between microRNAs and RNA-binding proteins determines developmental processes.
18160032 2007 A dead end for microRNAs.
18155131 2007 RNA-binding protein Dnd1 inhibits microRNA access to target mRNA.
18069663 2008 Analysis of the DND1 gene in men with sporadic and familial testicular germ cell tumors.
More...