Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.61
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23072936 The CCDC116 protein is expressed in all islet cell types except the glucagon and ghrelin cells.

AA Sequence

MARCRHHSGYLADDEASHSMCSARVQLPKKPLVPEMRPACKPGRVPHPPSTCGSSALQGQRRNKRHPQPF      1 - 70
GHFLDFLTESQVLDSLETVVEKATERMAAMKTEAGVPLVEVQDPVEVPSGGRRAHARPSLSTVHRHRVRP     71 - 140
TLCTGHPNNYPSSSSSMSNCHSSLMAGCLGSHSRDSDLGAQGSLPPVRDKLLLEKNLKRLLQLEREGKGL    141 - 210
SQSCSQRDSLLWDSLGSQTSFQWTQEQPLSWFSGLLGSSSGVPEASEPRPGEQEPIFRKREFNKEIKSLL    211 - 280
SQLESLDLPGYCPLREPHRTLNFLADHRLFPALQSVVSQAVDKLRGAHCRDGRPLFPTSLEPTSDLPPLG    281 - 350
SEPAKPTNGGQPYASPRPTVSSPKMLQRKRKDRGGSPSMSSAQVATRFKLKSPCSSSRFTKKKPLPSISS    351 - 420
KSSMSHFSNRLYEELADFLTQQAASLVIRKYEFEKDLSKQLGFFSFPITHVLRDLSLGLKKVKGSRIHLS    421 - 490
SETHRSCLLRKLEESKRAAAVSLEA                                                 491 - 515
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23072936 Expression of the coiled coil domain containing protein 116 in the pancreatic islets and endocrine pancreatic tumors.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...