Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.45
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8IYX1 B9A6M2
Symbols MgcRabGAP

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (2)

PMID Text
24938310 Data indicate that single-nucleotide polymorphisms (SNPs) distributing in not only lysyl oxidase-like 1 gene (LOXL1) but also TBC1 domain family member 21 protein (TBC1D21) and promyelocytic leukemia protein (PML).
21128978 MgcRabGAP is involved in acrosome/acroplaxome formation and cytoskeletal reorganization via Rab activity during mammalian spermiogenesis

AA Sequence

MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFL      1 - 70
TGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPLGNVLI     71 - 140
DKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVAKNLDML    141 - 210
STLITFLDPVFAEHLKGKGAGAVQSLFPWFCFCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQ    211 - 280
MVREQVLQESMGGDDILLACNNLIDLDADELISAACVVYAELIQKDVPQTLKDFFL                  281 - 336
//

Text Mined References (9)

PMID Year Title
24938310 2014 Novel common variants and susceptible haplotype for exfoliation glaucoma specific to Asian population.
21128978 2011 Identification and characterization of a novel Rab GTPase-activating protein in spermatids.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16923123 2006 Screening for target Rabs of TBC (Tre-2/Bub2/Cdc16) domain-containing proteins based on their Rab-binding activity.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.