Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.45
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Glaucoma 239 0.0 1.6
Type 2 diabetes mellitus 272 0.0 1.1
Disease Target Count Z-score Confidence
Exfoliation Syndrome 12 3.797 1.9

Expression

Gene RIF (2)

AA Sequence

MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFL      1 - 70
TGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPLGNVLI     71 - 140
DKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVAKNLDML    141 - 210
STLITFLDPVFAEHLKGKGAGAVQSLFPWFCFCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQ    211 - 280
MVREQVLQESMGGDDILLACNNLIDLDADELISAACVVYAELIQKDVPQTLKDFFL                  281 - 336
//

Text Mined References (9)

PMID Year Title