Property Summary

NCBI Gene PubMed Count 43
Grant Count 9
R01 Count 6
Funding $413,604.28
PubMed Score 28.74
PubTator Score 52.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.558 0.000
hereditary spastic paraplegia -1.032 0.007
ovarian cancer 2.200 0.000

Gene RIF (31)

PMID Text
26675234 The association of RNF168 with PML NBs resulted in increased ubiquitylation.
25999347 CK2/WIP1-mediated modulation of LSD1 phosphorylation facilitates RNF168-dependent ubiquitination and recruitment of 53BP1 to the DNA damage sites.
25894431 Results reveal an important role of USP7 in regulating ubiquitin-dependent signaling via stabilization of RNF168.
25578731 The ubiquitin ligase RNF168 is strictly dependent on the activity that UbK27 is required to promote chromatin ubiquitination following DNA damage.
25337968 Depletion of RNF8 or RNF168 blocks the degradation of diffusely localized nuclear 53BP1.
25304081 Finding that RNF8 is less abundant than RNF168 identifies RNF8 as a rate-limiting determinant of focal repair complex assembly
24634510 The E3 ligase RNF168 promotes both H2A ubiquitylation and neddylation. RNF168 is itself a substrate for NEDD8, and neddylation of RNF168 is necessary for its E3 ubiquitin activity.
24603765 The acidic patch functions within the nucleosome as nucleosomes containing a mutated acidic patch exhibit defective H2A/H2AXub by RNF168 and RING1B/BMI1 in vitro
24324146 Before their localization to DNA double strand breaks, RNF168 interacts with 53BP1 and modifies it through the addition of a chain of ubiquitin-polypeptides.
24217620 RNF168 physically interacts with LSD1 and we find this interaction to be important for LSD1 recruitment to DNA damage sites.
More...

AA Sequence

MALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNS      1 - 70
LVNVELWTIIQKHYPRECKLRASGQESEEVADDYQPVRLLSKPGELRREYEEEISKVAAERRASEEEENK     71 - 140
ASEEYIQRLLAEEEEEEKRQAEKRRRAMEEQLKSDEELARKLSIDINNFCEGSISASPLNSRKSDPVTPK    141 - 210
SEKKSKNKQRNTGDIQKYLTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQ    211 - 280
ISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGKELCVLSHERPKTRVPYSKETAVMPCGR    281 - 350
TESGCAPTSGVTQTNGNNTGETENEESCLLISKEISKRKNQESSFEAVKDPCFSAKRRKVSPESSPDQEE    351 - 420
TEINFTQKLIDLEHLLFERHKQEEQDRLLALQLQKEVDKEQMVPNRQKGSPDEYHLRATSSPPDKVLNGQ    421 - 490
RKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQK    491 - 560
SVFQMFQRCTK                                                               561 - 571
//

Text Mined References (47)

PMID Year Title
26675234 2016 Identification of RNF168 as a PML nuclear body regulator.
25999347 2015 Modulation of LSD1 phosphorylation by CK2/WIP1 regulates RNF168-dependent 53BP1 recruitment in response to DNA damage.
25894431 2015 USP7 deubiquitinase promotes ubiquitin-dependent DNA damage signaling by stabilizing RNF168.
25578731 2015 RNF168 promotes noncanonical K27 ubiquitination to signal DNA damage.
25337968 2014 Regulation of 53BP1 protein stability by RNF8 and RNF168 is important for efficient DNA double-strand break repair.
25304081 2014 The ubiquitin ligases RNF8 and RNF168 display rapid but distinct dynamics at DNA repair foci in living cells.
24634510 2014 RNF168-mediated H2A neddylation antagonizes ubiquitylation of H2A and regulates DNA damage repair.
24603765 2014 Nucleosome acidic patch promotes RNF168- and RING1B/BMI1-dependent H2AX and H2A ubiquitination and DNA damage signaling.
24324146 2013 RNF168 ubiquitylates 53BP1 and controls its response to DNA double-strand breaks.
24217620 2013 The histone demethylase LSD1/KDM1A promotes the DNA damage response.
More...