Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.3e-21
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 2.4e-02
psoriasis 1.500 9.3e-21

Gene RIF (1)

AA Sequence

MAFRRQVKNFVKNYSDAEIKVREATSNDPWGPSSSLMLDISDLTFNTISLSEIMNMLWHRLNDHGKNWRH      1 - 70
VYKSLTLMDYLIKNGSKKVIQHCREGFCNLQTLKDFQHIDEAGKDQGYYIREKSKQVITLLMDEPLLCKE     71 - 140
REVACRTRQRTSHSILFSKRQLGSSNSLTACTSAPTPDISASEKKYKLPKFGRLHNKRNVCKAGLKQEHC    141 - 210
QDVHLPTETMLSQETLPLKIHGWKSTEDLMTFLDDDPELPLLATPPSIVSPITCLSEAEEVCNLSGADAV    211 - 280
PTLSENSPSGQRDVSLDKRSDGIFTNTVTENLLETPLEKQSAAEGLKTLTILPACWSSKEEFISPDLRVS    281 - 350
KSDSTFHNQASVETLCLSPSFKIFDRVKEIVINKAYQKPAQSSIQMDDKILKTTTRVSTASEGASSFSPL    351 - 420
SMSSPDLASPEKSAHLLSPILAGPSFWTLSHQQLSSTSFKDEDKTAKLHHSFASRGPVSSDVEENDSLNL    421 - 490
LGILPNNSDSAKKNISHISSSHWGEFSTQNVDQFIPLSCSGFQSTKDFPQEPEAKNSISVLLREVKRAIA    491 - 560
RLHEDLSTVIQELNVINNILMSMSLNSSQISQSSQVPQSSEGSSDQI                           561 - 607
//

Text Mined References (6)

PMID Year Title