Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $226,561
PubMed Score 138.29
PubTator Score 67.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession Q8IYV9 Q6Q8P6 Q6Q8P7
Symbols OBF
IZUMO

Gene

 Grant Application (2)

PDB

5F4E   5JKC   5JKD   5JKE   5F4T   5F4V   5JK9  

Gene RIF (6)

PMID Text
27309818 crystal structures of human IZUMO1 and JUNO in unbound and bound conformations
27309808 crystal structures of human IZUMO1, JUNO and the IZUMO1-JUNO complex, establishing the structural basis for the IZUMO1-JUNO-mediated sperm-oocyte interaction
23279005 these findings indicate that human sperm expresses Izumo protein, and the immunoinfertile female sera have circulating isoantibodies against this protein.
18082733 We observed in our populations two combinations of four polymorphisms that appeared to be preferentially linked (CGG-CG and TAA-TT) without any significant difference between different genotype repartitions.
18082733 Observational study of gene-disease association. (HuGE Navigator)
15759005 human sperm contain Izumo and addition of the antibody against human Izumo left the sperm unable to fuse with zona-free hamster eggs [Izumo]

AA Sequence

MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLN      1 - 70
EDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCG     71 - 140
VMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLV    141 - 210
SKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPKMIKEEKPSPNIVTPGEATTESSISL    211 - 280
QPLQPEKMLASRLLGLLICGSLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ    281 - 350
//

Text Mined References (18)

PMID Year Title
27309818 2016 Molecular architecture of the human sperm IZUMO1 and egg JUNO fertilization complex.
27309808 2016 Structure of IZUMO1-JUNO reveals sperm-oocyte recognition during mammalian fertilization.
24739963 2014 Juno is the egg Izumo receptor and is essential for mammalian fertilization.
23636237 2013 Genome-wide meta-analysis of observational studies shows common genetic variants associated with macronutrient intake.
23372041 2013 Novel locus including FGF21 is associated with dietary macronutrient intake.
23279005 2013 Presence and incidence of izumo antibodies in sera of immunoinfertile women and men.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22957301 2012 Positive Selection and the Evolution of izumo Genes in Mammals.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
More...