Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.22
PubTator Score 6.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.009 3.4e-02
psoriasis 1.100 9.0e-04
hereditary spastic paraplegia -1.239 5.6e-03
progressive supranuclear palsy -1.500 1.6e-02
ovarian cancer -1.500 2.0e-04

Gene RIF (6)

PMID Text
24560927 MICU1 and MICU2 have roles in tuning the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity
24503055 Expression of MICU2 mutants lacking functional Ca2+-binding sites leads to a striking loss of Ca2+ uptake in HEK293 cells.
23409044 The results identify MICU2 as a new component of the uniporter complex that may contribute to the tissue-specific regulation of this channel.
23409044 regulation of MCU-mediated mitochondrial calcium handling
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQ      1 - 70
KNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQ     71 - 140
TAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDL    141 - 210
MTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRK    211 - 280
EDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEF    281 - 350
KRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK    351 - 420
GVKEVWKQAGKGLF                                                            421 - 434
//

Text Mined References (24)

PMID Year Title
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26903221 2016 Functional roles of MICU1 and MICU2 in mitochondrial Ca(2+) uptake.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24560927 2014 MICU1 and MICU2 finely tune the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity.
24503055 2014 MICU1 and MICU2 play nonredundant roles in the regulation of the mitochondrial calcium uniporter.
24231807 2013 EMRE is an essential component of the mitochondrial calcium uniporter complex.
23409044 2013 MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
22925203 2012 Inactivation of Pde8b enhances memory, motor performance, and protects against age-induced motor coordination decay.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826745 2002 Molecular genetic delineation of a deletion of chromosome 13q12-->q13 in a patient with autism and auditory processing deficits.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124993 2000 DCAMKL1 encodes a protein kinase with homology to doublecortin that regulates microtubule polymerization.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.