Property Summary

NCBI Gene PubMed Count 19
Grant Count 1
R01 Count 1
Funding $88,086.5
PubMed Score 5.22
PubTator Score 6.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.009 0.034
psoriasis 1.100 0.001
hereditary spastic paraplegia -1.239 0.006
progressive supranuclear palsy -1.500 0.016
ovarian cancer -1.500 0.000

Synonym

Accession Q8IYU8 Q8N0T6 Q8NAX8
Symbols EFHA1
1110008L20Rik

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
24560927 MICU1 and MICU2 have roles in tuning the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity
24503055 Expression of MICU2 mutants lacking functional Ca2+-binding sites leads to a striking loss of Ca2+ uptake in HEK293 cells.
23409044 The results identify MICU2 as a new component of the uniporter complex that may contribute to the tissue-specific regulation of this channel.
23409044 regulation of MCU-mediated mitochondrial calcium handling
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQ      1 - 70
KNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQ     71 - 140
TAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDL    141 - 210
MTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRK    211 - 280
EDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEF    281 - 350
KRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK    351 - 420
GVKEVWKQAGKGLF                                                            421 - 434
//

Text Mined References (24)

PMID Year Title
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26903221 2016 Functional roles of MICU1 and MICU2 in mitochondrial Ca(2+) uptake.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24560927 2014 MICU1 and MICU2 finely tune the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity.
24503055 2014 MICU1 and MICU2 play nonredundant roles in the regulation of the mitochondrial calcium uniporter.
More...