Property Summary

NCBI Gene PubMed Count 18
Grant Count 20
R01 Count 11
Funding $1,921,298.63
PubMed Score 10.63
PubTator Score 7.22

Knowledge Summary

Patent (2,153)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
astrocytic glioma -1.400 0.036
ependymoma -1.200 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -2.100 0.000
tuberculosis 1.700 0.000
adult high grade glioma -2.000 0.000
group 4 medulloblastoma 1.100 0.001
subependymal giant cell astrocytoma -1.547 0.015
lung adenocarcinoma -1.100 0.000
spina bifida 1.055 0.041
progressive supranuclear palsy -1.100 0.032
ovarian cancer -2.200 0.000
pituitary cancer 1.100 0.004

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

PMID Text
26920049 miR-26b was down-regulated in LNCaP, DU145, C4-2 and PC-3 cells compared to the two normal prostate cells RWPE-1 and WPMY-1 except DU145 cells. This inversely correlates with ULK2 level in the same cell lines.
26052940 Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity.
25925668 a novel signaling pathway identified whereby starvation-induced activation of ULK leads to phosphorylation of endogenous DENND3, with subsequent activation of Rab12 and initiation of membrane trafficking events required for autophagy
24923441 Glioblastoma and glioma cell lines had low levels of ULK2 transcripts. ULK2 promoter methylation and transcript levels showed significant negative correlation.
21475306 In response to DNA damage, ULK1 and ULK2 are upregulated by p53. The upregulation of ULK1 (ULK2)/ATG13 complex by p53 is necessary for the sustained autophagy activity induced by DNA damage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19225151 The ULK-Atg13-FIP200 complexes are direct targets of mTOR and important regulators of autophagy in response to mTOR signaling.
12471243 First identification and naming of ULK2 as an ortholog of mouse ULK2.

AA Sequence

MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVA      1 - 70
LYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLS     71 - 140
YANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVG    141 - 210
KPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSC    211 - 280
PVPVPMYSGSVSGSSCGSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDT    281 - 350
DDFVLVPHNISSDHSCDMPVGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST    351 - 420
ASSGTNVHGSPRSAVVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPLVGTIPEQFSQ    421 - 490
CCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHTGAGYS    491 - 560
YSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAE    561 - 630
EQSKDGNEPRECAHCLLVQGSERQRAEQQSKAVFGRSVSTGKLSDQQGKTPICRHQGSTDSLNTERPMDI    631 - 700
APAGACGGVLAPPAGTAASSKAVLFTVGSPPHSAAAPTCTHMFLRTRTTSVGPSNSGGSLCAMSGRVCVG    701 - 770
SPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECV    771 - 840
LDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQIKSGK    841 - 910
LSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDE    911 - 980
MFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKCSIERRLSALCHSTATV                  981 - 1036
//

Text Mined References (25)

PMID Year Title
26920049 2016 MiR-26b inhibits autophagy by targeting ULK2 in prostate cancer cells.
26052940 2015 ULK2 Ser 1027 Phosphorylation by PKA Regulates Its Nuclear Localization Occurring through Karyopherin Beta 2 Recognition of a PY-NLS Motif.
25925668 2015 Phosphorylation of the exchange factor DENND3 by ULK in response to starvation activates Rab12 and induces autophagy.
24923441 2014 Methylation silencing of ULK2, an autophagy gene, is essential for astrocyte transformation and tumor growth.
21795849 2011 ULK1 inhibits the kinase activity of mTORC1 and cell proliferation.
21690395 2011 Ammonia-induced autophagy is independent of ULK1/ULK2 kinases.
21475306 2011 Upregulation of human autophagy-initiation kinase ULK1 by tumor suppressor p53 contributes to DNA-damage-induced cell death.
21460635 2011 The requirement of uncoordinated 51-like kinase 1 (ULK1) and ULK2 in the regulation of autophagy.
21460634 2011 Ulk1-mediated phosphorylation of AMPK constitutes a negative regulatory feedback loop.
21205641 2011 Phosphorylation of ULK1 (hATG1) by AMP-activated protein kinase connects energy sensing to mitophagy.
More...