Property Summary

Ligand Count 6
NCBI Gene PubMed Count 22
PubMed Score 12.08
PubTator Score 7.22

Knowledge Summary

Patent (2,153)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.100 2.0e-06
adult high grade glioma -1.500 1.1e-04
astrocytic glioma -1.400 3.6e-02
atypical teratoid / rhabdoid tumor -1.500 1.2e-05
ependymoma -1.200 5.7e-07
glioblastoma -1.200 4.9e-04
group 4 medulloblastoma 1.100 1.2e-03
lung adenocarcinoma -1.100 1.6e-13
medulloblastoma, large-cell -1.300 7.0e-03
ovarian cancer -1.200 7.0e-13
pituitary cancer 1.100 3.6e-03
progressive supranuclear palsy -1.100 3.2e-02
spina bifida 1.055 4.1e-02
subependymal giant cell astrocytoma -1.395 6.9e-03
tuberculosis 1.400 9.6e-06

Gene RIF (11)

AA Sequence

MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVA      1 - 70
LYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLS     71 - 140
YANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVG    141 - 210
KPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSC    211 - 280
PVPVPMYSGSVSGSSCGSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDT    281 - 350
DDFVLVPHNISSDHSCDMPVGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST    351 - 420
ASSGTNVHGSPRSAVVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPLVGTIPEQFSQ    421 - 490
CCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHTGAGYS    491 - 560
YSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAE    561 - 630
EQSKDGNEPRECAHCLLVQGSERQRAEQQSKAVFGRSVSTGKLSDQQGKTPICRHQGSTDSLNTERPMDI    631 - 700
APAGACGGVLAPPAGTAASSKAVLFTVGSPPHSAAAPTCTHMFLRTRTTSVGPSNSGGSLCAMSGRVCVG    701 - 770
SPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECV    771 - 840
LDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQIKSGK    841 - 910
LSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDE    911 - 980
MFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKCSIERRLSALCHSTATV                  981 - 1036
//

Text Mined References (29)

PMID Year Title