Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.74
PubTator Score 3.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count P-value
posterior fossa group B ependymoma 416 2.6e-05
medulloblastoma, large-cell 6241 2.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 5.0
Disease Target Count Z-score Confidence
Tinea capitis 14 4.47 2.2
Restless legs syndrome 27 3.307 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 2.2e-04
posterior fossa group B ependymoma 1.400 2.6e-05

Gene RIF (2)

AA Sequence

MELSYQTLKFTHQAREACEMRTEARRKNLLILISHYLTQEGYIDTANALEQETKLGLRRFEVCDNIDLET      1 - 70
ILMEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDT     71 - 140
KSLNKEHPNQEVVDNTRLESANFGLHISRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFD    141 - 210
HNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLF    211 - 280
TGILSPWKGLLLYGPPGTGKTLLAKAVATECKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTI    281 - 350
FLDELESVMSQRGTASGGEHEGSLRMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLRRLEKRILV    351 - 420
DLPSREARQAMIYHWLPPVSKSRALELHTELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIFDALENH    421 - 490
QSESSDLPRIQLDIVTTADFLDVLTHTKPSAKNLAQRYSDWQREFESV                          491 - 538
//

Text Mined References (14)

PMID Year Title