Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $21,926
PubMed Score 3.24
PubTator Score 3.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
posterior fossa group B ependymoma 1.400 0.000

Gene RIF (2)

PMID Text
23018867 KATNAL2 methylation correlates with severity of cervical intraepithelial neoplasia
22495311 results from de novo events and a large parallel case-control study provide strong evidence in favour of CHD8 and KATNAL2 as genuine autism risk factors

AA Sequence

MELSYQTLKFTHQAREACEMRTEARRKNLLILISHYLTQEGYIDTANALEQETKLGLRRFEVCDNIDLET      1 - 70
ILMEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDT     71 - 140
KSLNKEHPNQEVVDNTRLESANFGLHISRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFD    141 - 210
HNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLF    211 - 280
TGILSPWKGLLLYGPPGTGKTLLAKAVATECKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTI    281 - 350
FLDELESVMSQRGTASGGEHEGSLRMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLRRLEKRILV    351 - 420
DLPSREARQAMIYHWLPPVSKSRALELHTELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIFDALENH    421 - 490
QSESSDLPRIQLDIVTTADFLDVLTHTKPSAKNLAQRYSDWQREFESV                          491 - 538
//

Text Mined References (9)

PMID Year Title
23018867 2012 Genome-wide methylation profiling identifies hypermethylated biomarkers in high-grade cervical intraepithelial neoplasia.
22495311 2012 Patterns and rates of exonic de novo mutations in autism spectrum disorders.
21173776 2012 Meta-analysis of genome-wide association studies for personality.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.